DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Co-option of a default secretory pathway for plant immune responses. Co-option of a default secretory pathway for plant immune responses. Nature 2008 imex curation Kwon C., Neu C., Pajonk S., Yun HS., Lipka U., Humphry M., Bau S., Straus M., Kwaaitaal M., Rampelt H., El Kasmi F., Jürgens G., Parker J., Panstruga R., Lipka V., Schulze-Lefert P. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kwon C., Neu C., Pajonk S., Yun HS., Lipka U., Humphry M., Bau S., Straus M., Kwaaitaal M., Rampelt H., El Kasmi F., Jürgens G., Parker J., Panstruga R., Lipka V., Schulze-Lefert P. DIP original experiment: DIP-250285X Nature 2008 IMEx Co-option of a default secretory pathway for plant immune responses. Co-option of a default secretory pathway for plant immune responses. Co-option of a default secretory pathway for plant immune responses. Nature 2008 imex curation Kwon C., Neu C., Pajonk S., Yun HS., Lipka U., Humphry M., Bau S., Straus M., Kwaaitaal M., Rampelt H., El Kasmi F., Jürgens G., Parker J., Panstruga R., Lipka V., Schulze-Lefert P. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kwon C., Neu C., Pajonk S., Yun HS., Lipka U., Humphry M., Bau S., Straus M., Kwaaitaal M., Rampelt H., El Kasmi F., Jürgens G., Parker J., Panstruga R., Lipka V., Schulze-Lefert P. DIP original experiment: DIP-250287X Nature 2008 IMEx Co-option of a default secretory pathway for plant immune responses. Co-option of a default secretory pathway for plant immune responses. Co-option of a default secretory pathway for plant immune responses. Nature 2008 imex curation Kwon C., Neu C., Pajonk S., Yun HS., Lipka U., Humphry M., Bau S., Straus M., Kwaaitaal M., Rampelt H., El Kasmi F., Jürgens G., Parker J., Panstruga R., Lipka V., Schulze-Lefert P. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kwon C., Neu C., Pajonk S., Yun HS., Lipka U., Humphry M., Bau S., Straus M., Kwaaitaal M., Rampelt H., El Kasmi F., Jürgens G., Parker J., Panstruga R., Lipka V., Schulze-Lefert P. DIP original experiment: DIP-250288X Nature 2008 IMEx Co-option of a default secretory pathway for plant immune responses. Co-option of a default secretory pathway for plant immune responses. Co-option of a default secretory pathway for plant immune responses. Nature 2008 imex curation Kwon C., Neu C., Pajonk S., Yun HS., Lipka U., Humphry M., Bau S., Straus M., Kwaaitaal M., Rampelt H., El Kasmi F., Jürgens G., Parker J., Panstruga R., Lipka V., Schulze-Lefert P. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kwon C., Neu C., Pajonk S., Yun HS., Lipka U., Humphry M., Bau S., Straus M., Kwaaitaal M., Rampelt H., El Kasmi F., Jürgens G., Parker J., Panstruga R., Lipka V., Schulze-Lefert P. DIP original experiment: DIP-250286X Nature 2008 IMEx Co-option of a default secretory pathway for plant immune responses. snp33_arath SNAP25 homologous protein SNAP33 Synaptosomal-associated protein SNAP25-like 1 Snap25a SNAP33 SNAP33B MAF19.21 At5g61210 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFGLRKSPANLPKHNSVDLKSSKPNPFDSDDESDNKHTLNPSKRTTSEPSLADMTNPFGGERVQKGDSSSSKQSLFSNSKYQYKNNFRDSGGIENQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHDQGEQITRTHHKAVEIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPVVTRDDSPTRRVNHLEKREKLGLNSAPRGQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNKGLDHLHDDVDELNFRVQQSNQRGRRLLGK DIP protein Q9S7P9 original sequence version: 89 685A0484608C6DE7 sy121_arath Syntaxin-121 SYP121 SYR1 Syntaxin-related protein At-Syr1 F26K24.11 At3g11820 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNDLFSSSFSRFRSGEPSPRRDVAGGGDGVQMANPAGSTGGVNLDKFFEDVESVKEELKELDRLNETLSSCHEQSKTLHNAKAVKDLRSKMDGDVGVALKKAKMIKVKLEALDRANAANRSLPGCGPGSSSDRTRTSVLNGLRKKLMDSMDSFNRLRELISSEYRETVQRRYFTVTGENPDERTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVKDIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTDQLQTARVYQKNTRKWTCIAIIILIIIITVVVLAVLKPWNNSSGGGGGGGGGGTTGGSQPNSGTPPNPPQARRLLR DIP protein Q9ZSD4 original sequence version: 106 8A6E2390761A8446 va722_arath Vesicle-associated membrane protein 722 VAMP722 HAT24 SAR1 Synaptobrevin-related protein 1 F25I18.14 At2g33120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK DIP protein P47192 original sequence version: 103 880AA7BA2C24697B snap33-syp121-1 1 6 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 5 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association snap33-syp121-2 2 6 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association syp121-snap33-1 3 6 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 5 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association snap33-syp121-3 4 6 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 5 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction