DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68251X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68254X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68256X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68255X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68250X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68252X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68257X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68253X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. orc6_human Origin recognition complex subunit 6 ORC6 ORC6L protein protein human Homo sapiens Human MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE DIP protein Q9Y5N6 original sequence version: 119 DIP protein Q9Y5N6 original sequence version: 56 DIP protein Q9Y5N6 original sequence version: 130 78840387605F45FE orc4_human Origin recognition complex subunit 4 ORC4 ORC4L protein protein human Homo sapiens Human MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL DIP protein O43929 original sequence version: 134 DIP protein O43929 original sequence version: 65 A7020B6690E30B4E orc1_human Origin recognition complex subunit 1 ORC1 ORC1L PARC1 Replication control protein 1 protein protein human Homo sapiens Human MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPACDSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELGNLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQPDKLQTLSPALKAPEKTRETGLSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPSVILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSSSDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKDE DIP protein Q13415 original sequence version: 131 DIP protein Q13415 original sequence version: 64 DIP protein Q13415 original sequence version: 100 DIP protein Q13415 original sequence version: 105 5C594553F7F808E2 orc2_human Origin recognition complex subunit 2 ORC2 ORC2L protein protein human Homo sapiens Human MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKSVSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA DIP protein Q13416 original sequence version: 117 DIP protein Q13416 original sequence version: 56 DIP protein Q13416 original sequence version: 94 DF3F9C2CF147DA5F orc5_human Origin recognition complex subunit 5 ORC5 ORC5L protein protein human Homo sapiens Human MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVFVNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTVYIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFPDYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIARTVNFDIIKYLYDFL DIP protein O43913 original sequence version: 116 DIP protein O43913 original sequence version: 53 DIP protein O43913 original sequence version: 90 0FEB0E829C124745 hmga1_human High mobility group protein HMG-I/HMG-Y High mobility group AT-hook protein 1 HMGA1 HMGIY High mobility group protein R protein protein human Homo sapiens Human MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ DIP protein P17096 original sequence version: 100 E9C4E3F2200914B8 hmga1-orc6-1 5 9 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association hmga1-orc1-1 4 11 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 14 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction hmga1-orc6-2 8 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction orc4-orc6-2 3 9 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 10 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction orc2-hmga1-1 1 14 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association hmga1-orc6-3 2 9 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 14 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction orc6-hmga1-1 6 14 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association orc5-orc6-3 7 9 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 13 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction