DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. Nature 2008 imex curation de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. DIP original experiment: DIP-259514X Nature 2008 IMEx A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. Nature 2008 imex curation de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. DIP original experiment: DIP-259519X Nature 2008 IMEx A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. Nature 2008 imex curation de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. DIP original experiment: DIP-259515X Nature 2008 IMEx A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. Nature 2008 imex curation de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. DIP original experiment: DIP-259518X Nature 2008 IMEx A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. Nature 2008 imex curation de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. DIP original experiment: DIP-259517X Nature 2008 IMEx A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. A molecular framework for light and gibberellin control of cell elongation. Nature 2008 imex curation de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined de Lucas M., Davière JM., Rodríguez-Falcón M., Pontin M., Iglesias-Pedraz JM., Lorrain S., Fankhauser C., Blázquez MA., Titarenko E., Prat S. DIP original experiment: DIP-259516X Nature 2008 IMEx A molecular framework for light and gibberellin control of cell elongation. pif3_arath Transcription factor PIF3 Phytochrome-associated protein 3 Basic helix-loop-helix protein 8 PIF3 PAP3 BHLH8 At1g09530 F14J9.19 Transcription factor EN 100 bHLH transcription factor bHLH008 Phytochrome-interacting factor 3 EN100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPLFELFRLTKAKLESAQDRNPSPPVDEVVELVWENGQISTQSQSSRSRNIPPPQANSSRAREIGNGSKTTMVDEIPMSVPSLMTGLSQDDDFVPWLNHHPSLDGYCSDFLRDVSSPVTVNEQESDMAVNQTAFPLFQRRKDGNESAPAASSSQYNGFQSHSLYGSDRARDLPSQQTNPDRFTQTQEPLITSNKPSLVNFSHFLRPATFAKTTNNNLHDTKEKSPQSPPNVFQTRVLGAKDSEDKVLNESVASATPKDNQKACLISEDSCRKDQESEKAVVCSSVGSGNSLDGPSESPSLSLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKSLQLQVQIMSMASGYYLPPAVMFPPGMGHYPAAAAAMAMGMGMPYAMGLPDLSRGGSSVNHGPQFQVSGMQQQPVAMGIPRVSGGGIFAGSSTIGNGSTRDLSGSKDQTTTNNNSNLKPIKRKQGSSDQFCGSS DIP protein O80536 original sequence version: 116 DIP protein O80536 original sequence version: 85 1044AC01D598DE7C rga_arath DELLA protein RGA RGA GRS RGA1 At2g01570 F2I9.19 Repressor on the ga1-3 mutant GAI-related sequence Restoration of growth on ammonia protein 1 GRAS family protein 10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKRDHHQFQGRLSNHGTSSSSSSISKDKMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLATDTVHYNPSELYSWLDNMLSELNPPPLPASSNGLDPVLPSPEICGFPASDYDLKVIPGNAIYQFPAIDSSSSSNNQNKRLKSCSSPDSMVTSTSTGTQIGGVIGTTVTTTTTTTTAAGESTRSVILVDSQENGVRLVHALMACAEAIQQNNLTLAEALVKQIGCLAVSQAGAMRKVATYFAEALARRIYRLSPPQNQIDHCLSDTLQMHFYETCPYLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPTFRLTGIGPPAPDNSDHLHEVGCKLAQLAEAIHVEFEYRGFVANSLADLDASMLELRPSDTEAVAVNSVFELHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPNSQDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLSTAAY DIP protein Q9SLH3 original sequence version: 84 DIP protein Q9SLH3 original sequence version: 75 DIP protein Q9SLH3 original sequence version: 102 FC92E7F9408072AA pif4_arath Transcription factor PIF4 Transcription factor EN 102 bHLH transcription factor bHLH009 Basic helix-loop-helix protein 9 Short under red-light 2 PIF4 BHLH9 SRL2 At2g43010 MFL8.13 EN102 Phytochrome-interacting factor 4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEHQGWSFEENYSLSTNRRSIRPQDELVELLWRDGQVVLQSQTHREQTQTQKQDHHEEALRSSTFLEDQETVSWIQYPPDEDPFEPDDFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPPPKFRLTNSSSGIRETEMEQYSVTTVGPSHCGSNPSQNDLDVSMSHDRSKNIEEKLNPNASSSSGGSSGCSFGKDIKEMASGRCITTDRKRKRINHTDESVSLSDAIGNKSNQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTDKASILDEAIDYLKSLQLQLQVMWMGSGMAAAAASAPMMFPGVQPQQFIRQIQSPVQLPRFPVMDQSAIQNNPGLVCQNPVQNQIISDRFARYIGGFPHMQAATQMQPMEMLRFSSPAGQQSQQPSSVPTKTTDGSRLDH DIP protein Q8W2F3 original sequence version: 103 DIP protein Q8W2F3-1 original sequence version: 120 B4C081D0BF907C26 rga-pif3-1 1 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rga-pif4-1 5 9 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 8 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association rga-pif3-2 2 7 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rga-pif4-2 3 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pif4-rga-1 6 9 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 8 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association rga-pif4-3 4 9 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction