DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. Only protein-protein interactions tobac Nicotiana tabacum (Common tobacco) Common tobacco fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. DIP original experiment: DIP-68192X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. DIP original experiment: DIP-68191X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. DIP original experiment: DIP-68194X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. Only protein-protein interactions tobac Nicotiana tabacum (Common tobacco) Common tobacco fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. DIP original experiment: DIP-68193X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. sgs3_sollc Protein SUPPRESSOR OF GENE SILENCING 3 SGS3 SlSGS3 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MSFSKWGGKPSNSSEKQKASSTPTVEEINRGVGDIGLNSEQNEGWEVYARKPKNKGGSSAGKQWAPQNPSPKAWGNQNTKAWGHPDVGKKSGTRNNAGSGRGSGNNWSTPSDPQKLARPHLYDGGFPSSAPVPPALKNGWDWSSRVASAHPKDNSQVAAAADDDKASEHDAEDNELDFLDESDDDLHSDDFDSDVGEMSYETRKKNPWFNQLFHSLDSLTVTEINEPERQWHCPACKGGPGAIEWFTGLQSLMTHAKTKGLRVKIHRELAELLEEDLRQRGTSVVPPGEVYGRWGGMEFKDKEIVWPPMVIIMNTRLDKDENDKWIGMGNQELLEYFSSYAAVKARHSYGPQGHRGMSLLIFEASAVGYIEADRLSEHFSENGRNRDAWERRSARFYPGGKRLLYGYMADKKDIDNFNQHSAGKSKLKFEMRSYKEAVWNPAKQMREDNQQLIWFKNKAAKHQMQAKALEESLSLVSEKHRQTLEENKIVRLKTKMHHEQIKEEMEFQEQFFKDQIKIIHDARTAREDNFEKTQQEQREMVKQSNANTASVEDHRVRAEKVAKFIKLQDKEMEEFVEERENLMRTHDDRIAALRRKYWEEEVELERKFDLELSKLMEKYSPKQSDEVNSSGTM DIP protein A5YVF1 original sequence version: 3 q764f6_9gemi Protein V2 V2 protein protein tomato yellow leaf curl virus-mild [japan:atumi] tomato yellow leaf curl virus-mild [japan:atumi] MWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRDLISVVRARDYVEATRRYNHFHARLEGSPKAELRQPIQQPCCCPHCPRHKQATIMDVQAHVPEAQNIQNVSKP D506F6E5AAF534BB sgs3_arath Protein SUPPRESSOR OF GENE SILENCING 3 SGS3 MQM1.17 At5g23570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSRAGPMSKEKNVQGGYRPEVEQLVQGLAGTRLASSQDDGGEWEVISKKNKNKPGNTSGKTWVSQNSNPPRAWGGQQQGRGSNVSGRGNNVSGRGNGNGRGIQANISGRGRALSRKYDNNFVAPPPVSRPPLEGGWNWQARGGSAQHTAVQEFPDVEDDVDNASEEENDSDALDDSDDDLASDDYDSDVSQKSHGSRKQNKWFKKFFGSLDSLSIEQINEPQRQWHCPACQNGPGAIDWYNLHPLLAHARTKGARRVKLHRELAEVLEKDLQMRGASVIPCGEIYGQWKGLGEDEKDYEIVWPPMVIIMNTRLDKDDNDKWLGMGNQELLEYFDKYEALRARHSYGPQGHRGMSVLMFESSATGYLEAERLHRELAEMGLDRIAWGQKRSMFSGGVRQLYGFLATKQDLDIFNQHSQGKTRLKFELKSYQEMVVKELRQISEDNQQLNYFKNKLSKQNKHAKVLEESLEIMSEKLRRTAEDNRIVRQRTKMQHEQNREEMDAHDRFFMDSIKQIHERRDAKEENFEMLQQQERAKVVGQQQQNINPSSNDDCRKRAEEVSSFIEFQEKEMEEFVEEREMLIKDQEKKMEDMKKRHHEEIFDLEKEFDEALEQLMYKHGLHNEDD DIP protein Q9LDX1 original sequence version: 26 mint 456E2A1396706A96 v2-sgs3-1 2 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction v2-sgs3-2 3 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction v2-sgs3-3 1 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco 6 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco direct interaction direct interaction v2-sgs3-4 4 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco 6 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco direct interaction direct interaction