UniProt UniProt http://www.uniprot.org Impaired placental trophoblast lineage differentiation in Alkbh1(-/-) mice. Impaired placental trophoblast lineage differentiation in Alkbh1(-/-) mice. Developmental dynamics : an official publication of the American Association of Anatomists 2008 imex curation Pan Z., Sikandar S., Witherspoon M., Dizon D., Nguyen T., Benirschke K., Wiley C., Vrana P., Lipkin SM. slipkin@uci.edu 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pan Z., Sikandar S., Witherspoon M., Dizon D., Nguyen T., Benirschke K., Wiley C., Vrana P., Lipkin SM. slipkin@uci.edu Accepted 2017-MAR-14 AT 14:13 GMT AT 14:13 GMT by MGT mouse e12.5 embryo and placenta cDNA Developmental dynamics : an official publication of the American Association of Anatomists 2008 imex curation Impaired placental trophoblast lineage differentiation in Alkbh1(-/-) mice. Impaired placental trophoblast lineage differentiation in Alkbh1(-/-) mice. Developmental dynamics : an official publication of the American Association of Anatomists 2008 imex curation Pan Z., Sikandar S., Witherspoon M., Dizon D., Nguyen T., Benirschke K., Wiley C., Vrana P., Lipkin SM. slipkin@uci.edu 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan Z., Sikandar S., Witherspoon M., Dizon D., Nguyen T., Benirschke K., Wiley C., Vrana P., Lipkin SM. Origin of transfected FLAG-HDAC4 according publications of Dr. Yang, McGill University, Montreal,Canada (provided plasmid according to m+m, see UniProt) slipkin@uci.edu Accepted 2017-MAR-14 AT 14:13 GMT AT 14:13 GMT by MGT Developmental dynamics : an official publication of the American Association of Anatomists 2008 imex curation hdac4_human Histone deacetylase 4 HDAC4 KIAA0288 protein protein human Homo sapiens Human MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL DIP protein P56524 original sequence version: 158 DIP protein P56524 original sequence version: 149 DIP protein P56524 original sequence version: 151 BB7FD37652D12398 dnjb6_mouse DnaJ homolog subfamily B member 6 Heat shock protein J2 MRJ mDj4 Dnajb6 Hsj2 Mrj protein protein mouse Mus musculus Mouse MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFDDFFGNRRGPRGNRSRGAGSFFSTFSGFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEEDGQLKSLTINGVADENALAEECQRRGQPTPALAPGPAPAPVRVPSQARPLAPTPAPTPAPTPAPAPAQTPAPSVSTRPQKPPRPAPTAKLGSKSNWEDDEQDRQRVPGNWDAPMTSAGLKEGGKRKKQKQKEDLKKKKSTKGNH 7B0102218E8DAA99 o54946-2 DnaJ homolog subfamily B member 6 Dnajb6 Hsj2 Mrj Heat shock protein J2 MRJ mDj4 protein protein mouse Mus musculus Mouse MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFDDFFGNRRGPRGNRSRGAGSFFSTFSGFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEEDGQLKSLTINGKEHLLRLDNK 3B56053C3BB0735D alkb1_mouse Nucleic acid dioxygenase ALKBH1 Alkbh1 Abh Alkbh Alkylated DNA repair protein alkB homolog 1 Alpha-ketoglutarate-dependent dioxygenase ABH1 DNA 6mA demethylase DNA lyase ABH1 DNA oxidative demethylase ALKBH1 tRNA N1-methyl adenine demethylase DNA N6-methyl adenine demethylase ALKBH1 mRNA N(3)-methylcytidine demethylase protein protein mouse Mus musculus Mouse MGKMAAAVASLATLAAEPREDAFRKLFRFYRQSRPGTADLGAVIDFSEAHLARSPKPGVPQVVRFPLNVSSVTERDAERVGLEPVSKWRAYGLEGYPGFIFIPNPFLPGCQRHWVKQCLKLYSQKPNVCNLDKHMTKEETQGLWEQSKEVLRSKEVTKRRPRSLLERLRWVTLGYHYNWDSKKYSADHYTPFPSDLAFLSEQVATACGFQGFQAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLKRDEAPTAMFMHSGDIMVMSGFSRLLNHAVPRVLPHPDGECLPHCLETPLPAVLPSNSLVEPCSVEDWQVCATYLRTARVNMTVRQVLATGQDFPLEPVEETKRDIAADGLCHLHDPNSPVKRKRLNPNS D18C019F0CB9C0A5 alkb1_human Nucleic acid dioxygenase ALKBH1 ABH ABH1 ALKBH ALKBH1 Alkylated DNA repair protein alkB homolog 1 Alpha-ketoglutarate-dependent dioxygenase ABH1 DNA 6mA demethylase DNA lyase ABH1 DNA oxidative demethylase ALKBH1 DNA N6-methyl adenine demethylase ALKBH1 mRNA N(3)-methylcytidine demethylase protein protein human Homo sapiens Human MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPDS 539C4CE41D2D8AEC alkbh1-dnajb6-1 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association no fig. alkbh1-dnajb6-2 2 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6F dnajb6-alkbh1-1 2 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6 G/I hdac4-dnajb6-1 2 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6E dnajb6-hdac4-1 2 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6I Alkbh1 Association is decreasing and abolished with increasing amounts of Myc-Alkbh1 cotransfected