DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the catalytic mechanism of phosphothreonine lyase. Structural basis for the catalytic mechanism of phosphothreonine lyase. Nature structural & molecular biology 2008 imex curation Chen L., Wang H., Zhang J., Gu L., Huang N., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro phosphatase assay phosphatase assay western blot western blot Immuno blot Immuno blot Chen L., Wang H., Zhang J., Gu L., Huang N., Zhou JM., Chai J. DIP original experiment: DIP-113693X Nature structural & molecular biology 2008 IMEx Structural basis for the catalytic mechanism of phosphothreonine lyase. Structural basis for the catalytic mechanism of phosphothreonine lyase. Structural basis for the catalytic mechanism of phosphothreonine lyase. Nature structural & molecular biology 2008 imex curation Chen L., Wang H., Zhang J., Gu L., Huang N., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen L., Wang H., Zhang J., Gu L., Huang N., Zhou JM., Chai J. DIP original experiment: DIP-113692X Nature structural & molecular biology 2008 IMEx Structural basis for the catalytic mechanism of phosphothreonine lyase. geatvya GEATVYA Peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GEATVYA spvc_salty MAPK phosphothreonine lyase spvC 27.5 kDa virulence protein Secreted effector protein SpvC mkaD vsdD PSLT038 protein protein salty Salmonella typhimurium MPINRPNLNLNIPPLNIVAAYDGAEIPSTNKHLKNNFNSLHNQMRKMPVSHFKEALDVPDYSGMRQSGFFAMSQGFQLNNHGYDVFIHARRESPQSQGKFAGDKFHISVLRDMVPQAFQALSGLLFSEDSPVDKWKVTDMEKVVQQARVSLGAQFTLYIKPDQENSQYSASFLHKTRQFIECLESRLSENGVISGQCPESDVHPENWKYLSYRNELRSGRDGGEMQRQALREEPFYRLMTE 77625271D78F8814 mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P28482 original sequence version: 173 DIP protein P28482 original sequence version: 103 DIP protein P28482 original sequence version: 101 DIP protein P28482 original sequence version: 131 DIP protein P28482 original sequence version: 156 DIP protein P28482 original sequence version: 166 DIP protein P28482 original sequence version: 144 E85D0B2A5D2D724E geatvya-spvc-1 2 3 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mapk1-spvc-1 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 4 enzyme enzyme unspecified role unspecified role P0A2M9:p.Phe100Glu F100E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F100E'. Wed May 02 14:45:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe100glu' Tue Jun 30 19:10:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe100Glu' P0A2M9:p.Tyr158Glu Y158E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y E This feature has been corrected as a result of our quality control procedures. The original label was 'Y158E'. Wed May 02 16:08:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr158glu' Tue Jun 30 16:44:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr158Glu' P0A2M9:p.Phe86Asp F86D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D This feature has been corrected as a result of our quality control procedures. The original label was 'F86D'. Wed May 02 19:32:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe86asp' Tue Jun 30 18:30:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe86Asp' P0A2M9:p.Lys104Ala K104A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K104A'. Wed May 02 19:43:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys104ala' Tue Jun 30 16:31:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys104Ala' P0A2M9:p.His106Ala H106A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H106A'. Wed May 02 20:00:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his106ala' Tue Jun 30 17:15:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His106Ala' P0A2M9:p.Lys136Ala K136A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K136A'. Wed May 02 18:25:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys136ala' Tue Jun 30 16:35:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys136Ala' P0A2M9:p.Arg148Ala R148A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R148A'. Wed May 02 14:39:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg148ala' Tue Jun 30 16:00:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg148Ala' P0A2M9:p.Val149Asp V149D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D This feature has been corrected as a result of our quality control procedures. The original label was 'V149D'. Wed May 02 19:09:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val149asp' Tue Jun 30 16:34:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val149Asp' P0A2M9:p.Arg213Ala R213A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R213A'. Wed May 02 15:51:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg213ala' Tue Jun 30 16:26:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg213Ala' P0A2M9:p.Arg220Ala R220A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R220A'. Wed May 02 15:58:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg220ala' Tue Jun 30 17:58:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg220Ala' P0A2M9:p.[Arg148Ala;Arg220Ala] R148A/R220A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R148A/R220A'. Wed May 02 16:15:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg148ala,arg220ala' Tue Jun 30 19:04:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg148Ala;Arg220Ala]' ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation