DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Human neutrophils uniquely release TIMP-free MMP-9 to provide a potent catalytic stimulator of angiogenesis. Human neutrophils uniquely release TIMP-free MMP-9 to provide a potent catalytic stimulator of angiogenesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ardi VC., Kupriyanova TA., Deryugina EI., Quigley JP. Only protein-protein interactions human Homo sapiens Human comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Ardi VC., Kupriyanova TA., Deryugina EI., Quigley JP. DIP original experiment: DIP-68747X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Human neutrophils uniquely release TIMP-free MMP-9 to provide a potent catalytic stimulator of angiogenesis. Human neutrophils uniquely release TIMP-free MMP-9 to provide a potent catalytic stimulator of angiogenesis. Human neutrophils uniquely release TIMP-free MMP-9 to provide a potent catalytic stimulator of angiogenesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ardi VC., Kupriyanova TA., Deryugina EI., Quigley JP. Only protein-protein interactions human Homo sapiens Human comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Ardi VC., Kupriyanova TA., Deryugina EI., Quigley JP. DIP original experiment: DIP-68746X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Human neutrophils uniquely release TIMP-free MMP-9 to provide a potent catalytic stimulator of angiogenesis. mmp9_human Matrix metalloproteinase-9 MMP9 CLG4B 92 kDa type IV collagenase 92 kDa gelatinase Gelatinase B protein protein human Homo sapiens Human MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED DIP protein P14780 original sequence version: 114 DIP protein P14780 original sequence version: 120 2165AC8CA1466209 ngal_human Neutrophil gelatinase-associated lipocalin Siderocalin LCN2 25 kDa alpha-2-microglobulin-related subunit of MMP-9 HNL Lipocalin-2 NGAL Oncogene 24p3 p25 protein protein human Homo sapiens Human MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG DIP protein P80188 original sequence version: 93 DIP protein P80188 original sequence version: 140 CD761805723FEF1E mmp9-2 2 3 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association lcn2-mmp9-1 1 4 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 3 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association