DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Weiske J., Albring KF., Huber O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68735X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Weiske J., Albring KF., Huber O. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68737X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Weiske J., Albring KF., Huber O. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68733X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Weiske J., Albring KF., Huber O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68731X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Weiske J., Albring KF., Huber O. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68732X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Weiske J., Albring KF., Huber O. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68736X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Weiske J., Albring KF., Huber O. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68734X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Weiske J., Albring KF., Huber O. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Weiske J., Albring KF., Huber O. DIP original experiment: DIP-68738X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity. lef1_human Lymphoid enhancer-binding factor 1 LEF1 T cell-specific transcription factor 1-alpha protein protein human Homo sapiens Human MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI DIP protein Q9UJU2 original sequence version: 136 DIP protein Q9UJU2 original sequence version: 73 D480D440698EEFE3 ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E fhit_human Bis(5'-adenosyl)-triphosphatase Diadenosine 5',5'''-P1,P3-triphosphate hydrolase Dinucleosidetriphosphatase AP3A hydrolase Fragile histidine triad protein FHIT Adenosine 5'-monophosphoramidase FHIT Adenylylsulfatase Adenylylsulfate-ammonia adenylyltransferase protein protein human Homo sapiens Human MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ DIP protein P49789 original sequence version: 79 14D85961A19ECF3E fhit-fhit-6 2 11 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey Binding region 74-147 Binding region 74-147 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction fhit-ctnnb1-1 4 10 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association ctnnb1-fhit-1 1 10 unspecified role unspecified role bait bait human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association lef1-fhit-1 5 11 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 9 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ctnnb1-fhit-2 6 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 11 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association lef1-ctnnb1-5 7 11 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli association association lef1-ctnnb1-6 8 9 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction ctnnb1-fhit-3 3 10 unspecified role unspecified role bait bait Binding region 683-781 Binding region 683-781 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey Binding region 1-75 Binding region 1-75 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction