DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Guo M., Jin S., Sun D., Hew CL., Pan SQ. Only protein-protein interactions rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo M., Jin S., Sun D., Hew CL., Pan SQ. DIP original experiment: DIP-68754X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Guo M., Jin S., Sun D., Hew CL., Pan SQ. Only protein-protein interactions rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo M., Jin S., Sun D., Hew CL., Pan SQ. DIP original experiment: DIP-68751X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Guo M., Jin S., Sun D., Hew CL., Pan SQ. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Guo M., Jin S., Sun D., Hew CL., Pan SQ. DIP original experiment: DIP-68750X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx f.2, f.4 Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Guo M., Jin S., Sun D., Hew CL., Pan SQ. Only protein-protein interactions rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo M., Jin S., Sun D., Hew CL., Pan SQ. DIP original experiment: DIP-68752X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Guo M., Jin S., Sun D., Hew CL., Pan SQ. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Guo M., Jin S., Sun D., Hew CL., Pan SQ. DIP original experiment: DIP-68753X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Recruitment of conjugative DNA transfer substrate to Agrobacterium type IV secretion apparatus. q7d3v8_agrfc HEPN domain-containing protein Atu5117 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MKTSLDHIPPQIQTELQRALEIIHEEFEDALEGGTAKFKKRGRILKIILFGSYARGTQVDEPFTSKGYRSDFDLLVIVNNRKLTDFAEYWYKAADRLIRDKMIKRPVQIIVHSLREVNTSLQESQHFFSDIRKEGIALYELDDKPLAEPKTLTPEEQLRVAKEHFEKRFGAGRNFAALSDAALQKGMISEAAFLLHQAIEQAYASVLLTLTNYTPASHNLKVLRSFAEERDRRLIEAFPRDHHRERAWFNTINEAYVKARYSSQYKISQEALDWIGERATLLLSLVGEVCRDHISALERDAGREIAEQGAAEE D59D8B675E9F07E8 q8vt82_rhird virE2 protein protein rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens MDPNAITPSGNDVYELLRPHAAENEGDLKAKRQKLPEHLSDLMDEGEKTFNLSQESVDAPSSASSSITDDQQVEYIAALLKEIPLLPGAARRPDEYILVVGTGSGRVTGTVKGKLGRLPTRDEFNNACRLYRDGAGNYFPPPQAYNRILVPDEIEDKAAFRKDVWYKAHREMNISGTRMYFDLDPKYPLDKYGKLRPEDQYTETAYGRRKVQRHYLHSFQAGMLLPDIMIKTPDNDVYFVSRSENDRYTNKTFQEFEAIIKRTYGSESEIKLKSESGIMHDSKYLDAWQQGSADIRFASYAGEVRTHNPDLPHAIVNLKSDVRPQDVFLSVEAVFQSPGNPWAEALKRGELWDRILIRDRTGNTYKTPQRLMYSDRDHFKKILDRVGLPHGIGEFTEATATKYERFQTQAAVLVADGAIIKDIRSLSAEERTQAVTAHVLLADRNSQNQRKGTYTSLLEYARTKEQLPHDVADLLGHPIDYFSHDRVQPAPERPPIVYSGDPRTFVRVRDQTVNNL DIP protein Q8VT82 original sequence version: 19 virbb_rhird Protein VirB11 virB11 protein protein rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens MEVDPQLRFLLKPILEWLDDPKTEEIAINRPGEAFVRQAGIFTKMPLPVSYDDLEDIAILAGALRKQDVGPRNPLCATELPGGERLQICLPPTVPSGTVSLTIRRPSSRVSGLKEVSSRYDASRWNQWQTRRKRQNQDDEAILQHFDNGDLEAFLHACVVSRLTMLLCGPTGSGKTTMSKTLISAIPPQERLITIEDTLELVIPHDNHVRLLYSKNGAGLGAVSAEHLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPIQGFKKLFSLVKSSVQGASLEDRTLIDMLSTAIDVIIPFRAYEDVYEVGEIWLAADARRRGETIGDLLNQ DIP protein P0A3F8 original sequence version: 19 vird2_rhird T-DNA border endonuclease VirD2 virD2 protein protein rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens MPDRAQVIIRIVPGGGTKTLQQIINQLEYLSRKGKLELQRSARHLDIPVPPDQIRELAQSWVTEAGIYDESQSDDDRQQDLTTHIIVSFPAGTDQTAAYEASREWAAEMFGSGYGGGRYNYLTAYHVDRDHPHLHVVVNRRELLGHGWLKISRRHPQLNYDGLRKKMAEISLRHGIVLDATSRAERGIAERPITYAEHRRLERMQAQKIQFEDTDFDETSPEEDRRDLSQSFDPFRSDPSTGEPDRATRHDKQPLEQHARFQESAGSSIKADARIRVSLESERSAQPSASKIPVIGHFGIETSYVAEASVRKRSGIFGTSRPVTDVAMHTVKRQQRSKRRNDEEAGPSGANRKGLKAAQVDSEANVGEQDTRDDSNKAADPVSASIGTEQPEASPKRPRDRHDGELGGRKRARGNRRDDGRGGT DIP protein P06668 original sequence version: 47 vird4_rhird Protein VirD4 virD4 protein protein rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens MNSSKTSPQRMTLSIVCSLAAGFCAASCYVTFRRGFNGEAIMTFDVFAFWYETPLYLGYASTVFWRGLSVVIFTSLAVLSSQLIISLRNQKHHGTARWAEIGEMQHAGYLQRYSRIKGPIFGKTCGPLWFGSYLTNGEQPHSLVVAPTRAGKGVGIVIPTLLTFKGSVIALDVKGELFELTSRARKASGDAVFKFSPLDSERKTHCYNPVLDIATLPPERQFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKYKLFAQLAEESLNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLIKAATSRSDFSVYDLRRKKTCIYLCVSPNDLEVLAPLMRLLFQQLVSILQRSLPGKDECHEVLFLLDEFKHLGKLEAIETAITTIAGYKGRFMFIIQSLSALTGTYDDAGKQNFLSNTGVQVFMATADDETPTYISKAIGEYTFKARSTSYSQASMFDHNIQISDQGAALLRPEQVRLLDDQSEIVLIKGRPPLKLRKVQYYSDRTLKRLFERQMGSLPEPAPLMLSDYSNDQVQSHLAEIANFNEDAAPRNRTVAEDHGSVKVGADIPERVMGINGDEDQADAREIPPELGCASRIDAGSGRSTAIVGPDYCTSAKIEVRTGTACEMKLNWVQFVSGGMLRFDKVYARSQLSLYEVSV DIP protein P09817 original sequence version: 49 43BF81126FFC3C46 virb4_rhird Protein virB4 virB4 protein protein rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens MLGASGTTERSGEIYLPYIGHLSDHIVLLEDGSIMSIARIDGVAFELEEIEMRNARCRAFNTLLRNIADDHVSIYAHLVRHADVPSSAPRHFRSVFAASLNEAFEQRVLSGQLLRNDHFLTLIVYPQAALGKVKRRFTKLSGKRENDLAGQIRNMEDLWHVVAGSLKAYGLHRLGIREKQGVLFTEIGEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKDSYVGSIYSFREYPAKTRPGMLNALLSLDFPLVLTQSFSFLTRPQAHAKLSLKSSQMLSSGDKAVTQIGKLSEAEDALASNEFVMGSHHLSLCVYADDLNSLGDRGARARTRMADAGAVVVQEGIGMEAAYWSQLPGNFKWRTRPGAITSRNFAGFVSFENFPEGASSGHWGTAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMMFVLAMLEQSMVDRAGTVVFFDKDRGGELLVRATGGTYLALRRGTPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPQMRSIAGLREFLLHGPAEGAGARLQRWCRGHALGWAFDGEVDEVKLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGAMIDGRRFVMSCDEFRAYLLNPKFSAVVDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKEFQAIREDMTVGSRKFLLKRESGSVICEFDLRDMREYVAVLSGRANTVRFAARLREAQEGNSSGWLSEFMARHHEAED DIP protein P0A3W0 original sequence version: 14 93A8A5E80AA10298 vird2-vbp1-1 3 9 unspecified role unspecified role bait bait rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens 6 unspecified role unspecified role prey prey Q7D3V8:p.His218Ala mutation H218A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'mutation H218A'. Wed May 02 14:31:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his218ala' Tue Jun 30 17:07:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His218Ala' Q7D3V8:p.Arg260Ala mutation R260A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'mutation R260A'. Wed May 02 16:29:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg260ala' Tue Jun 30 16:03:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg260Ala' rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens physical association physical association vbp1-vird2-1 5 9 unspecified role unspecified role prey prey rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens 7 unspecified role unspecified role prey prey rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens 6 unspecified role unspecified role bait bait his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association vbp1-vird2-2 2 9 unspecified role unspecified role prey prey rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens 6 unspecified role unspecified role bait bait rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens physical association physical association vbp1-vire2-1 4 7 unspecified role unspecified role prey prey rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens 6 unspecified role unspecified role bait bait rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens physical association physical association vbp1-virb11-1 1 8 unspecified role unspecified role prey prey rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens 10 unspecified role unspecified role prey prey rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens 11 unspecified role unspecified role prey prey rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens 6 unspecified role unspecified role bait bait rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens association association