DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. DIP original experiment: DIP-111323X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. DIP original experiment: DIP-111321X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Declerck N., Bouillaut L., Chaix D., Rugani N., Slamti L., Hoh F., Lereclus D., Arold ST. DIP original experiment: DIP-111322X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. papr5 PapR5 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) LPFEF plcr PlcR protein protein protein bactu Bacillus thuringiensis MQAEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVYQNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNHAKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYEEAEIEDAYKKASFFFDILEMHAYKEALVNKISRLE plcr-1 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction papr5-plcr-1 3 4 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction papr5-plcr-2 1 4 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction