DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67972X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67968X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67973X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67967X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67962X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67975X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67969X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67978X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67965X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67974X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67966X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67960X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67971X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67970X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67963X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67961X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67976X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67964X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. Structure (London, England : 1993) 2007 imex curation Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura H., Yokoyama K., Koike H., Yamada M., Shimowasa A., Kabasawa M., Kawashima T., Suzuki M. DIP original experiment: DIP-67977X Structure (London, England : 1993) 2007 IMEx A structural code for discriminating between transcription signals revealed by the feast/famine regulatory protein DM1 in complex with ligands. q979l0_thevo TVG1179749 protein protein thevo thevo MDEKDRDILNLLIDNSRISNTEIAKVLNVSEGTVRKRIKKMIDEGIIKRFTVETSDNTIDALILVKIDNKKYKEVLQRLRARYYEIYEFSGRIDVAIRIKTDSTDNLNRIVDQIREIEGVVDTDTLIRLQ 8AF01E9937414AD9 o73983_pyrho PHS023 protein protein pyrho Pyrococcus horikoshii MVTAFILMVTAAGKEREVMEKLLAMPEVKEAYVVYGEYDLIVKVETDTLKDLDQFITEKIRKMPEIQMTSTMIAI 67F8C97935354FC1 reg6_pyrho HTH-type transcriptional regulator FL11 fl11 Feast/famine regulatory protein FL11 PH1519 protein protein pyrho Pyrococcus horikoshii MRVPLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALGYSMLAFILVKVKAGKYSEVASNLAKYPEIVEVYETTGDYDMVVKIRTKNSEELNNFLDLIGSIPGVEGTHTMIVLKTHKETTELPIK FD7BD105608588E6 dm3 Hypothetical protein PH1856.1n protein protein pyrho Pyrococcus horikoshii reg3_pyrho Uncharacterized HTH-type transcriptional regulator PH0140 PH0140 protein protein pyrho Pyrococcus horikoshii MITVPHSRKVELDEIDRAILRLLQEDGRMSYSEISRRINVPESTVRARVNRLVKEGVIRKFAALINPFKAGYEIVAFIAVDAEPAKVKQVVEELAKFPEVDVLGIVTGAHDIFMQVTVKDLQELERFILEKMAKIDGIKSTETSILTSVKKWGYARVF 8EBC6E37198BDB0D o74091_pyrho PHS045 protein protein pyrho Pyrococcus horikoshii MFILLVVRPGLENEVYEKLKDRPEVKEIYRLYGDYDIIIRLSVEGIKALDEFHDKVLRKLRGIEISETLIASSY D5B6AB9E85529E4F q97c07_thevo TVG0307586 protein protein thevo thevo MSIAFVLISTVPGKEHEVYNKVLKINGVVEAHPLFGEYDIIVKLDMKDFTEIGEVVIEKIRTIDGVIDTKTLTGIKL E5BC84D7CAE7E464 o57938_pyrho HTH crp-type domain-containing protein PH0199 protein protein pyrho Pyrococcus horikoshii MTRERVELTNRQIELLRKLYREGKTIEVHTVEKTQDELAQELGITRQALSNHLKILKELGYIRTGRGFIDLTDKALELLGEKRGDVFIFVKIEPTKRKQVYDTIRKLRVKKIYRVTGDIDLIIEADKSKLDEILEEIAALDGVKETITHVVLGVL C6344E2395A9AC74 dm1-fl11-1 18 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dm2-1 13 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dm3-1 14 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tvdm-1 19 26 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dm3-2 7 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dm1-fl11-2 15 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tvdm-2 8 26 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dm2-2 1 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dm1-1 5 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tvfl3-1 6 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction fl4-1 4 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction fl5-1 10 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dm1-2 12 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction fl11-1 11 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction fl5-2 3 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction fl11-2 9 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction fl4-2 2 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dm1-3 16 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tvfl3-2 17 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction