DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Alpha2-chimaerin interacts with EphA4 and regulates EphA4-dependent growth cone collapse. Alpha2-chimaerin interacts with EphA4 and regulates EphA4-dependent growth cone collapse. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Shi L., Fu WY., Hung KW., Porchetta C., Hall C., Fu AK., Ip NY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shi L., Fu WY., Hung KW., Porchetta C., Hall C., Fu AK., Ip NY. DIP original experiment: DIP-261831X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Alpha2-chimaerin interacts with EphA4 and regulates EphA4-dependent growth cone collapse. Alpha2-chimaerin interacts with EphA4 and regulates EphA4-dependent growth cone collapse. Alpha2-chimaerin interacts with EphA4 and regulates EphA4-dependent growth cone collapse. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Shi L., Fu WY., Hung KW., Porchetta C., Hall C., Fu AK., Ip NY. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shi L., Fu WY., Hung KW., Porchetta C., Hall C., Fu AK., Ip NY. DIP original experiment: DIP-261832X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Alpha2-chimaerin interacts with EphA4 and regulates EphA4-dependent growth cone collapse. epha4_mouse Ephrin type-A receptor 4 Tyrosine-protein kinase receptor SEK-1 Tyrosine-protein kinase receptor MPK-3 Epha4 Sek Sek1 protein protein mouse Mus musculus Mouse MAGIFYFILFSFLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEEQNGECQACKIGYYKALSTDASCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSKYNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGSESSRPNTALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMSQDDLARIGITAITHQNKILSSVQAMRTQMQQMHGRMVPV DIP protein Q03137 original sequence version: 161 DIP protein Q03137 original sequence version: 101 89BEB2C7CDB54A55 chin_rat N-chimaerin Chn1 Arhgap2 Chn N-chimerin Alpha-chimerin A-chimaerin Rho GTPase-activating protein 2 protein protein rat Rattus norvegicus (Rat) Rat MPSKESWSGRKTNRATVHKSKQEGRQQDLLIAALGMKLGSQKSSVTIWQPLKLFAYSQLTSLVRRATLKENEQIPKYEKVHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHITKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDAYPKFIESAKIVDPDEQLETLHEALRSLPPAHCETLRYLMAHLKRVTLHEKENLMSAENLGIVFGPTLMRSPELDPMAALNDIRYQRLVVELLIKNEDILF DIP protein P30337 original sequence version: 102 D4DB599737D171FB p15882-1 N-chimaerin CHN1 ARHGAP2 CHN A-chimaerin Alpha-chimerin N-chimerin Rho GTPase-activating protein 2 protein protein human Homo sapiens Human MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAADQLLIVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGIVFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF DIP protein P15882-1 original sequence version: 155 d3zen1_rat Efna4 Efna4_predicted rCG_62598 protein protein rat Rattus norvegicus (Rat) Rat MRLLPLLRTVLWAALLGSRLRGCSSLRHSIYWNSTNPRLLRGDAVVELGLNDYLDIFCPHYESPGPPEGPETFALYIVDWSGYEACKAEGANAFQRWNCTLPFAPFVPVRFSEKIQRFTPFPLGFEFLPGETYYYISVPTPESPGQCLRLQVSVCCKEDRSESAHPVGSPGESGTSGWRGGHAPSPLSLLLLLLLPILRLLRVL DIP protein D3ZEN1 original sequence version: 33 chn1-efna4-1 1 6 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 4 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association epha4-chn1-5 2 3 unspecified role unspecified role bait bait human Homo sapiens Human 5 unspecified role unspecified role prey prey P15882-1:p.Arg56Leu R56L mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R L This feature has been corrected as a result of our quality control procedures. The original label was 'R56L'. Wed May 02 17:23:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg56leu' Tue Jun 30 18:24:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg56Leu' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association