DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113444X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113443X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113446X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113441X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx P1 + P2P1 + P3 Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113445X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113442X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx confirmed with mammalian hybrid assay (dont know if it is appropriate in terms of DIP) Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113447X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113448X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113440X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx confirmed with mammalian hybrid assay (dont know if it is appropriate in terms of DIP) Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Sanyal S., Båvner A., Haroniti A., Nilsson LM., Lundåsen T., Rehnmark S., Witt MR., Einarsson C., Talianidis I., Gustafsson JA., Treuter E. DIP original experiment: DIP-113439X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx P1 + P2P1 + P3 hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 gps2_human G protein pathway suppressor 2 GPS2 protein protein human Homo sapiens Human MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK DIP protein Q13227 original sequence version: 63 DIP protein Q13227 original sequence version: 83 AE65DA578C978C9B nr0b2_human Nuclear receptor subfamily 0 group B member 2 NR0B2 SHP Orphan nuclear receptor SHP Small heterodimer partner protein protein human Homo sapiens Human MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREALDVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLLGDMLLLR DIP protein Q15466 original sequence version: 79 DIP protein Q15466 original sequence version: 113 14BEE2B3FF46154A q9wv81_mouse Gps2 protein protein mouse Mus musculus Mouse MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLQEKLSALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTGHYVGSEAAFAGTPEHGQFQGSPGGVYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGSTLSLQKQMEHANQQTSFSDSSSLRPMHPQALHPAPGLLASPQLPVQIQAAGKSGFATTSQPGPRLPFIQHSQNPRFYHK DIP protein Q9WV81 original sequence version: 20 q4qr41_xenla gps2.L LOC403370 gps2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPALLERPKLSNTMARALHRHVMMERERKRQEEEEVDKMMEQKLRDEQERRRKKEMEERMSLEETREQIMKLQDKLNSLQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLASAAYTQGMVMHTGAHLINMQGSPGGHSRNTSLMSDRAKQMFGPPVIAGRHYSSQTSFSPTAAEHGQYQSSPSSHGPYTVSQSQHSFAAGQAGPVNYAGSQPIRGPSAFQTMQYLSHQQPGYSMHSHYTGAHAGFMPTSTGIPLQKQLEHANQQSGFTDSSTLRPMHPQALQTLLPTPQITVPMQPAKSALSYSHPSRSASPGGYPHGTPPQQPHTSGFQASPQQNPRLPFMQHGQNQRFYHK 76479054EAF30620 nr0b2_rat Nuclear receptor subfamily 0 group B member 2 Nr0b2 Shp Orphan nuclear receptor SHP Small heterodimer partner protein protein rat Rattus norvegicus (Rat) Rat MSSSQSGVCPCQGSASHPTILYTLLSPGPRTRPMAPASRSHCLCQQHRPVRLCAPHRTCREALDVLGKTVAFLRNLPSFCLLPHEDQRRLLEGCWGPLFLLGLAQDTVTFEVAEAPVPSILKKILLEEPNSGAQGAQPPDPPQPSLAAVQWLQHCLESFWSLELGPKEYAYLKGTILFNPDVPGLHASCHIAHLQQEAHWALCEVLEPWYPASQGRLARILLMASTLKNISCTLLVDLFFRPVIGDVDITELLEDMLLLR DIP protein P97947 original sequence version: 57 gps2-hdac3-1 1 11 unspecified role unspecified role prey prey in vitro In vitro 13 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association gps2-nr0b2-1 10 14 unspecified role unspecified role prey prey in vitro In vitro 13 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction nr0b2-hdac3-1 3 11 unspecified role unspecified role prey prey in vitro In vitro 14 unspecified role unspecified role bait bait his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association nr0b2-gps2-1 6 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction nr0b2-hdac1-1 7 11 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait HA HA ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association gps2-hdac1-1 8 13 unspecified role unspecified role bait bait Ha tag Ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human association association nr0b2-gps2 x-1 9 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction gps2-hdac1-2 2 12 unspecified role unspecified role prey prey in vitro In vitro 13 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association nr0b2-hdac1-2 5 12 unspecified role unspecified role prey prey in vitro In vitro 14 unspecified role unspecified role bait bait his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association gps2-nr0b2-2 4 17 unspecified role unspecified role prey prey in vitro In vitro 13 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction