DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structural basis of Holliday junction resolution by T7 endonuclease I. The structural basis of Holliday junction resolution by T7 endonuclease I. Nature 2007 imex curation Hadden JM., Déclais AC., Carr SB., Lilley DM., Phillips SE. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hadden JM., Déclais AC., Carr SB., Lilley DM., Phillips SE. DIP original experiment: DIP-253069X Nature 2007 IMEx The structural basis of Holliday junction resolution by T7 endonuclease I. endo_bpt7 Endonuclease I Gene product 3 Junction-resolving enzyme gp3 3 protein protein bpt7 Enterobacteria phage T7 Bacteriophage T7 MAGYGAKGIRKVGAFRSGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFLLPNGIFVETKGLWESDDRKKHLLIREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEKHGIKFADKLIPAEWIKEPKKEVPFDRLKRKGGKK DIP protein P00641 original sequence version: 79 mint Endodeoxyribonuclease I, which is expressed in the late stage, is necessary for T3 genetic recombination and the breakdown of host DNA. In the early stage of infection, T3 DNA replicates as a linear monomer. In the late stage, the T3 DNA replicates via linear concatemers several genomes in length. The gene 3 product has also been implicated in the maturation of these concatemers D092AA28E3743BC1 endo_bpt7-1 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction