DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Spectroscopic validation of the pentameric structure of phospholamban. Spectroscopic validation of the pentameric structure of phospholamban. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Traaseth NJ., Verardi R., Torgersen KD., Karim CB., Thomas DD., Veglia G. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Traaseth NJ., Verardi R., Torgersen KD., Karim CB., Thomas DD., Veglia G. DIP original experiment: DIP-113879X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Spectroscopic validation of the pentameric structure of phospholamban. Spectroscopic validation of the pentameric structure of phospholamban. Spectroscopic validation of the pentameric structure of phospholamban. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Traaseth NJ., Verardi R., Torgersen KD., Karim CB., Thomas DD., Veglia G. Only protein-protein interactions ecolx Escherichia coli epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Traaseth NJ., Verardi R., Torgersen KD., Karim CB., Thomas DD., Veglia G. DIP original experiment: DIP-113881X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Spectroscopic validation of the pentameric structure of phospholamban. Spectroscopic validation of the pentameric structure of phospholamban. Spectroscopic validation of the pentameric structure of phospholamban. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Traaseth NJ., Verardi R., Torgersen KD., Karim CB., Thomas DD., Veglia G. Only protein-protein interactions ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Traaseth NJ., Verardi R., Torgersen KD., Karim CB., Thomas DD., Veglia G. DIP original experiment: DIP-113880X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Spectroscopic validation of the pentameric structure of phospholamban. ppla_rabit Cardiac phospholamban PLN protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL DIP protein P61015 original sequence version: 37 DIP protein P61015 original sequence version: 67 DIP protein P61015 original sequence version: 73 0763601F76A854D3 pln-6 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pln-2 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pln-3 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction