DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila. Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila. PLoS biology 2007 imex curation Kim LK., Choi UY., Cho HS., Lee JS., Lee WB., Kim J., Jeong K., Shim J., Kim-Ha J., Kim YJ. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim LK., Choi UY., Cho HS., Lee JS., Lee WB., Kim J., Jeong K., Shim J., Kim-Ha J., Kim YJ. DIP original experiment: DIP-67838X PLoS biology 2007 IMEx Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila. Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila. Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila. PLoS biology 2007 imex curation Kim LK., Choi UY., Cho HS., Lee JS., Lee WB., Kim J., Jeong K., Shim J., Kim-Ha J., Kim YJ. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim LK., Choi UY., Cho HS., Lee JS., Lee WB., Kim J., Jeong K., Shim J., Kim-Ha J., Kim YJ. DIP original experiment: DIP-67839X PLoS biology 2007 IMEx Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila. Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila. Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila. PLoS biology 2007 imex curation Kim LK., Choi UY., Cho HS., Lee JS., Lee WB., Kim J., Jeong K., Shim J., Kim-Ha J., Kim YJ. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim LK., Choi UY., Cho HS., Lee JS., Lee WB., Kim J., Jeong K., Shim J., Kim-Ha J., Kim YJ. DIP original experiment: DIP-67840X PLoS biology 2007 IMEx Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila. hdac1_drome Histone deacetylase HDAC1 HDAC1 Rpd3 CG7471 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASNTNSNNNSNNKSDNDAGATANAGSGSGSGSGAGAKGAKENNI DIP protein Q94517 original sequence version: 67 B0F6503D42A1BCE9 jra_drome Transcription factor AP-1 Jra jun CG2275 Jun-related antigen dJRA dJun protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKTPVSAAANLSIQNAGSSGATAIQIIPKTEPVGEEGPMSLDFQSPNLNTSTPNPNKRPGSLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILLSNNLMQTPQPGKVFPTKAGPVTVEQLDFGRGFEEALHNLHTNSQAFPSANSAANSAANNTTAAAMTAVNNGISGGTFTYTNMTEGFSVIKDEPVNQASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQ DIP protein P18289 original sequence version: 85 FCCA13A6D2AF32BF stat_drome Signal transducer and transcription activator Stat92E MARE Stat mrL CG4257 Protein marelle protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSLWKRISSHVDCEQRMAAYYEEKGMLELRLCLAPWIEDRIMSEQITPNTTDQLERVALKFNEDLQQKLLSTRTASDQALKFRVVELCALIQRISAVELYTHLRSGLQKELQLVTEKSVAATAGQSMPLNPYNMNNTPMVTGYMVDPSDLLAVSNSCNPPVVQGIGPIHNVQNTGIASPALGMVTPKVELYEVQHQIMQSLNEFGNCANALKLLAQNYSYMLNSTSSPNAEAAYRSLIDEKAAIVLTMRRSFMYYESLHEMVIHELKNWRHQQAQAGNGAPFNEGSLDDIQRCFEMLESFIAHMLAAVKELMRVRLVTEEPELTHLLEQVQNAQKNLVCSAFIVDKQPPQVMKTNTRFAASVRWLIGSQLGIHNNPPTVECIIMSEIQSQRFVTRNTQMDNSSLSGQSSGEIQNASSTMEYQQNNHVFSASFRNMQLKKIKRAEKKGTESVMDEKFALFFYTTTTVNDFQIRVWTLSLPVVVIVHGNQEPQSWATITWDNAFAEIVRDPFMITDRVTWAQLSVALNIKFGSCTGRSLTIDNLDFLYEKLQREERSEYITWNQFCKEPMPDRSFTFWEWFFAIMKLTKDHMLGMWKAGCIMGFINKTKAQTDLLRSVYGIGTFLLRFSDSELGGVTIAYVNENGLVTMLAPWTARDFQVLNLADRIRDLDVLCWLHPSDRNASPVKRDVAFGEFYSKRQEPEPLVLDPVTGYVKSTLHVHVCRNGENGSTSGTPHHAQESMQLGNGDFGMADFDTITNFENF DIP protein Q24151 original sequence version: 74 BF3A622A29899161 hmg2_drome High mobility group protein DSP1 Dsp1 ssrp2 CG12223 Protein dorsal switch 1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEHFHQIQQTIQHYQQQLAAQQQQQVQQQQLQQHQVVVQQNQQQAHQNSSNTTAGVGTQQLFTYKMASSFPNPATTMAQVVATSNAAGTTGYDYRLNMAQAAAAAAVPGSQWWYSAANQGQVDANTAAQLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVINSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQHDDDDGDGDDDENQ DIP protein Q24537 original sequence version: 67 FD270250B723FD31 dsp1-jra-1 3 4 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 5 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly association association stat92e-dsp1-1 2 4 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly 5 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly association association jra-dsp1-1 1 4 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 5 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly association association