DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Vertebrate heart growth is regulated by functional antagonism between Gridlock and Gata5. Vertebrate heart growth is regulated by functional antagonism between Gridlock and Gata5. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jia H., King IN., Chopra SS., Wan H., Ni TT., Jiang C., Guan X., Wells S., Srivastava D., Zhong TP. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jia H., King IN., Chopra SS., Wan H., Ni TT., Jiang C., Guan X., Wells S., Srivastava D., Zhong TP. DIP original experiment: DIP-113922X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Vertebrate heart growth is regulated by functional antagonism between Gridlock and Gata5. q09jy7_danre gata4 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MYQGVTMAANHGAASYESGFLHNSTSPVYVTPTRVTPMIQALPYLQAPQQSSPASGHSGWAQPGVETTSYNSSTGHHHSPVSRFTFSTSPPLTSGRDTATYTSREHFGSRALSGSYHSGYPAYVSPNIGASWTASHFDSSVLHSLQTGGAAAARHPNLEFFDDLGEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLVKPQRRLSASRRVGLSCTNCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNISKTKPGSSEGQSAISAVNSSPTEETRPIKTEPDTTPLYTHHNIHTQVSAFPAYMGSPSGSSSSKSEVWNSLILA DIP protein Q09JY7 original sequence version: 18 hey2_danre Hairy/enhancer-of-split related with YRPW motif protein 2 hey2 grl zgc:136746 Protein gridlock protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKRPCEDSTSDSDMDETIDVGSENNYSGQSNGSFIRCGSPTTTSQVMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHSLAMDFLSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSSCASQREAAAMTTSIAHHQQALHPHHWAAALHPIPAAFLQQSGLPSSESSSGRLSEAPQRGAALFSHSDSALRAPSTGSVAPCVPPLSTSLLSLSATVHAAAAAAAAQTFPLSFPAGFPLFSPSVTASSVASSTVSSSVSTSTTSQQSSGSSSKPYRPWGTEVGAF DIP protein Q9I9L0 original sequence version: 47 gata4-hey2-1 1 3 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 2 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association