DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. DIP original experiment: DIP-113919X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. DIP original experiment: DIP-113920X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. DIP original experiment: DIP-113918X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. DIP original experiment: DIP-113917X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Parthier C., Kleinschmidt M., Neumann P., Rudolph R., Manhart S., Schlenzig D., Fanghänel J., Rahfeld JU., Demuth HU., Stubbs MT. DIP original experiment: DIP-113916X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. gluc_human Pro-glucagon GCG protein protein human Homo sapiens Human MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK DIP protein P01275 original sequence version: 152 DIP protein P01275 original sequence version: 107 mint homomint 7A99EEC629B2862C gip_human Gastric inhibitory polypeptide Incretin hormone GIP Glucose-dependent insulinotropic polypeptide protein protein human Homo sapiens Human MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR DIP protein P09681 original sequence version: 77 mint 51F5FC388A8897EC gipr_human Gastric inhibitory polypeptide receptor GIPR Glucose-dependent insulinotropic polypeptide receptor protein protein human Homo sapiens Human MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDRLLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPVTEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC DIP protein P48546 original sequence version: 80 gip-gipr-1 3 7 unspecified role unspecified role unspecified role unspecified role Region 52-93 Region 52-93 binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role Region 24-138 Region 24-138 binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gip-gipr-2 5 7 unspecified role unspecified role unspecified role unspecified role Region 52-93 Region 52-93 binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role Region 24-138 Region 24-138 binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gcg-gipr-1 2 6 unspecified role unspecified role unspecified role unspecified role GLP-1 GLP-1 polyprotein frag polyprotein fragment polyprotein frag predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role Region 24-138 Region 24-138 binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gcg-gipr-2 1 6 unspecified role unspecified role unspecified role unspecified role GLP-1 GLP-1 polyprotein frag polyprotein fragment polyprotein frag predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role Region 24-138 Region 24-138 binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gip-gipr-3 4 7 unspecified role unspecified role unspecified role unspecified role Region 52-93 Region 52-93 binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role Region 24-138 Region 24-138 binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction