DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253094X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253095X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253091X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions nicbe Nicotiana benthamiana pull down pull down anti tag western anti tag western blot anti tag western Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253105X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253101X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions nicbe Nicotiana benthamiana pull down pull down predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253104X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253100X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions nicbe Nicotiana benthamiana pull down pull down predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253106X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions nicbe Nicotiana benthamiana pull down pull down predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253103X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253096X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253099X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253092X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253097X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253093X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253098X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. Nature 2007 imex curation Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. Only protein-protein interactions nicbe Nicotiana benthamiana pull down pull down predetermined predetermined participant predetermined Kim WY., Fujiwara S., Suh SS., Kim J., Kim Y., Han L., David K., Putterill J., Nam HG., Somers DE. DIP original experiment: DIP-253102X Nature 2007 IMEx ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light. spl11_arath Squamosa promoter-binding-like protein 11 SPL11 F17L21.14 At1g27360 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDCNMVSSSQWDWEHLIMSNPSRTEDDSKQLPTEWEIEKGEGIESIVPHFSGLERVSSGSATSFWHTAVSKSSQSTSINSSSPEAKRCKLASESSPGDSCSNIDFVQVKAPTALEVSVASAESDLCLKLGKRTYSEEYWGRNNNEISAVSMKLLTPSVVAGKSKLCGQSMPVPRCQIDGCELDLSSAKGYHRKHKVCEKHSKCPKVSVSGLERRFCQQCSRFHAVSEFDEKKRSCRKRLSHHNARRRKPQGVFSMNPERVYDRRQHTNMLWNGVSLNARSEEMYEWGNNTYDTKPRQTEKSFTLSFQRGNGSEDQLVASSSRMFSTSQTSGGFPAGKSKFQLHGEDVGEYSGVLHESQDIHRALSLLSTSSDPLAQPHVQPFSLLCSYDVVPK DIP protein Q9FZK0 original sequence version: 67 826CB25EE50CC61F gigan_arath Protein GIGANTEA GI At1g22770 T22J18.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTERNCLSKATTSGSPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASRGSGKHPQLMPSTPRWAVANGAGVILSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATPSATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIAMSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAEATIEATAQGIASMLCAHGPEVEWRICTIWEAAYGLIPLNSSAVDLPEIIVATPLQPPILSWNLYIPLLKVLEYLPRGSPSEACLMKIFVATVETILSRTFPPESSRELTRKARSSFTTRSATKNLAMSELRAMVHALFLESCAGVELASRLLFVVLTVCVSHEAQSSGSKRPRSEYASTTENIEANQPVSNNQTANRKSRNVKGQGPVAAFDSYVLAAVCALACEVQLYPMISGGGNFSNSAVAGTITKPVKINGSSKEYGAGIDSAISHTRRILAILEALFSLKPSSVGTPWSYSSSEIVAAAMVAAHISELFRRSKALTHALSGLMRCKWDKEIHKRASSLYNLIDVHSKVVASIVDKAEPLEAYLKNTPVQKDSVTCLNWKQENTCASTTCFDTAVTSASRTEMNPRGNHKYARHSDEGSGRPSEKGIKDFLLDASDLANFLTADRLAGFYCGTQKLLRSVLAEKPELSFSVVSLLWHKLIAAPEIQPTAESTSAQQGWRQVVDALCNVVSATPAKAAAAVVLQAERELQPWIAKDDEEGQKMWKINQRIVKVLVELMRNHDRPESLVILASASDLLLRATDGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHPSAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFNAASIDWKADIQNCLNWEAHSLLSTTMPTQFLDTAARELGCTISLSQ DIP protein Q9SQI2 original sequence version: 85 DIP protein Q9SQI2 original sequence version: 78 71CFDE7D39E73549 ado1_arath Adagio protein 1 ADO1 FKL2 Protein ZEITLUPE Clock-associated PAS protein ZTL LOV kelch protein 1 Flavin-binding kelch repeat F-box protein 1-like protein 2 F-box only protein 2b LKP1 ZTL MSF19.2 At5g57360 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEWDSGSDLSADDASSLADDEEGGLFPGGGPIPYPVGNLLHTAPCGFVVTDAVEPDQPIIYVNTVFEMVTGYRAEEVLGGNCRFLQCRGPFAKRRHPLVDSMVVSEIRKCIDEGIEFQGELLNFRKDGSPLMNRLRLTPIYGDDDTITHIIGIQFFIETDIDLGPVLGSSTKEKSIDGIYSALAAGERNVSRGMCGLFQLSDEVVSMKILSRLTPRDVASVSSVCRRLYVLTKNEDLWRRVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAAAWRKLSVGGSVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSDYPEWQHVKVSSPPPGRWGHTLTCVNGSNLVVFGGCGQQGLLNDVFVLNLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSIEKPVWREIPAAWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLKFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGVAPPPRLDHVAVNLPGGRILIFGGSVAGLHSASQLYLLDPTEDKPTWRILNIPGRPPRFAWGHGTCVVGGTRAIVLGGQTGEEWMLSELHELSLASYLT DIP protein Q94BT6 original sequence version: 95 B25192FCBE019093 aprr1_arath Two-component response regulator-like APRR1 APRR1 AIP1 TOC1 At5g61380 MFB13.16 Pseudo-response regulator 1 Timing of CAB expression 1 ABI3-interacting protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLNGECKGGDGFIDRSRVRILLCDNDSTSLGEVFTLLSECSYQVTAVKSARQVIDALNAEGPDIDIILAEIDLPMAKGMKMLRYITRDKDLRRIPVIMMSRQDEVPVVVKCLKLGAADYLVKPLRTNELLNLWTHMWRRRRMLGLAEKNMLSYDFDLVGSDQSDPNTNSTNLFSDDTDDRSLRSTNPQRGNLSHQENEWSVATAPVHARDGGLGADGTATSSLAVTAIEPPLDHLAGSHHEPMKRNSNPAQFSSAPKKSRLKIGESSAFFTYVKSTVLRTNGQDPPLVDGNGSLHLHRGLAEKFQVVASEGINNTKQARRATPKSTVLRTNGQDPPLVNGNGSHHLHRGAAEKFQVVASEGINNTKQAHRSRGTEQYHSQGETLQNGASYPHSLERSRTLPTSMESHGRNYQEGNMNIPQVAMNRSKDSSQVDGSGFSAPNAYPYYMHGVMNQVMMQSAAMMPQYGHQIPHCQPNHPNGMTGYPYYHHPMNTSLQHSQMSLQNGQMSMVHHSWSPAGNPPSNEVRVNKLDRREEALLKFRRKRNQRCFDKKIRYVNRKRLAERRPRVKGQFVRKMNGVNVDLNGQPDSADYDDEEEEEEEEEEENRDSSPQDDALGT DIP protein Q9LKL2 original sequence version: 103 EDBE0AA0B7FAB61E ado2_arath Adagio protein 2 LOV kelch protein 2 Flavin-binding kelch repeat F-box protein 1-like protein 1 F-box only protein 2c ADO2 FKL1 LKP2 At2g18915 F19F24.11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQNQMEWDSDSDLSGGDEVAEDGWFGGDNGAIPFPVGSLPGTAPCGFVVSDALEPDNPIIYVNTVFEIVTGYRAEEVIGRNCRFLQCRGPFTKRRHPMVDSTIVAKMRQCLENGIEFQGELLNFRKDGSPLMNKLRLVPIREEDEITHFIGVLLFTDAKIDLGPSPDLSAKEIPRISRSFTSALPIGERNVSRGLCGIFELSDEVIAIKILSQLTPGDIASVGCVCRRLNELTKNDDVWRMVCQNTWGTEATRVLESVPGAKRIGWVRLAREFTTHEATAWRKFSVGGTVEPSRCNFSACAVGNRIVIFGGEGVNMQPMNDTFVLDLGSSSPEWKSVLVSSPPPGRWGHTLSCVNGSRLVVFGGYGSHGLLNDVFLLDLDADPPSWREVSGLAPPIPRSWHSSCTLDGTKLIVSGGCADSGALLSDTFLLDLSMDIPAWREIPVPWTPPSRLGHTLTVYGDRKILMFGGLAKNGTLRFRSNDVYTMDLSEDEPSWRPVIGYGSSLPGGMAAPPPRLDHVAISLPGGRILIFGGSVAGLDSASQLYLLDPNEEKPAWRILNVQGGPPRFAWGHTTCVVGGTRLVVLGGQTGEEWMLNEAHELLLATSTTAST DIP protein Q8W420 original sequence version: 85 FDB9F994CBF0D017 ado3_arath Adagio protein 3 ADO3 Flavin-binding kelch repeat F-box protein 1 F-box only protein 2a At1g68050 FKF1 T23K23.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAREHAIGEATGKRKKRGRVEEAEEYCNDGIEEQVEDEKLPLEVGMFYYPMTPPSFIVSDALEPDFPLIYVNRVFEVFTGYRADEVLGRNCRFLQYRDPRAQRRHPLVDPVVVSEIRRCLEEGIEFQGELLNFRKDGTPLVNRLRLAPIRDDDGTITHVIGIQVFSETTIDLDRVSYPVFKHKQQLDQTSECLFPSGSPRFKEHHEDFCGILQLSDEVLAHNILSRLTPRDVASIGSACRRLRQLTKNESVRKMVCQNAWGKEITGTLEIMTKKLRWGRLARELTTLEAVCWRKFTVGGIVQPSRCNFSACAVGNRLVLFGGEGVNMQPLDDTFVLNLDAECPEWQRVRVTSSPPGRWGHTLSCLNGSWLVVFGGCGRQGLLNDVFVLDLDAKHPTWKEVAGGTPPLPRSWHSSCTIEGSKLVVSGGCTDAGVLLSDTFLLDLTTDKPTWKEIPTSWAPPSRLGHSLSVFGRTKILMFGGLANSGHLKLRSGEAYTIDLEDEEPRWRELECSAFPGVVVPPPRLDHVAVSMPCGRVIIFGGSIAGLHSPSQLFLIDPAEEKPSWRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHTGEEWILNELHELCLASRQDSDL DIP protein Q9C9W9 original sequence version: 93 AC90C0641149A3D8 ado2-gi-1 3 18 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 21 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction ado1-gi-1 2 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait Region 46-154 Region 46-154 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association gi-ado1-1 5 18 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 19 unspecified role unspecified role prey prey Region 46-241 Region 46-241 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q94BT6:p.Cys82Ala C82A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C82A'. Wed May 02 14:40:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys82ala' Tue Jun 30 16:15:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys82Ala' Q94BT6:p.Gly119Asp G119D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G119D'. Wed May 02 17:17:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly119asp' Tue Jun 30 17:34:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly119Asp' Q94BT6:p.Gly46Glu G46E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G E This feature has been corrected as a result of our quality control procedures. The original label was 'G46E'. Wed May 02 16:04:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly46glu' Tue Jun 30 17:46:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly46Glu' nicbe Nicotiana benthamiana physical association physical association gi-ado2-1 7 21 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association gi-ado1-2 6 18 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 19 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association ado3-gi-1 12 22 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 18 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction gi-ado1-3 10 18 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey Region 46-154 Region 46-154 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ado3-gi-2 13 22 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association gi-ado2-2 4 21 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 18 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association ado1-gi-2 14 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 18 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction gi-ado3-1 15 22 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ado3-gi-3 8 22 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 18 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association gi-ado1-4 16 18 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 19 unspecified role unspecified role prey prey nicbe Nicotiana benthamiana physical association physical association ado2-gi-2 11 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spl11-gi-1 1 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 18 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction aprr1-ado1-1 9 20 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 19 unspecified role unspecified role prey prey nicbe Nicotiana benthamiana physical association physical association