DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Nature 2007 imex curation Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253117X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Nature 2007 imex curation Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253118X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Nature 2007 imex curation Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253115X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Nature 2007 imex curation Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253112X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Nature 2007 imex curation Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253114X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Nature 2007 imex curation Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253116X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Nature 2007 imex curation Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253113X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Nature 2007 imex curation Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253111X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. pti1_sollc Pto-interacting protein 1 Pto kinase interactor 1 PTI1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MSCFSCCDDDDMHRATDNGPFMAHNSAGNNGGQRATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDENVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLNTDYPPKAIAKMAAVAALCVQYEADFRPNMSIVVKALQPLLPRPVPS DIP protein Q41328 original sequence version: 84 mint A6C5346175FCEE97 q08242_psesx EIZ61_05000 avrP protein protein psesx Pseudomonas syringae MGNICVGGSRMAHQVNSPDRVSNNSGDEDNVTSSQLLSVRHQLAESAGLPRDQHEFVSSQAPQSLRNRYNNLYSHTQRTLDMADMQHRYMTGASGINPGMLPHENVDDMRSAITDWSDMREALQHAMGIHADIPPSPERFVATMNPSGSIRMSTLSPSPYRNWQ DIP protein Q08242 original sequence version: 32 q40234_solpi Pto protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI DIP protein Q40234 original sequence version: 100 mint 3258F4BA1491151D pti1-pto-1 3 9 enzyme target enzyme target substrate substrate unspecified role unspecified role Q41328:p.Lys96Gln K96Q mutation mutation certain certain sequence position certain certain certain sequence position certain K Q This feature has been corrected as a result of our quality control procedures. The original label was 'K96Q'. Wed May 02 18:34:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys96gln' Tue Jun 30 20:19:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys96Gln' ecolx Escherichia coli 11 enzyme enzyme unspecified role unspecified role Q40234:p.Thr199Ala T199A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T199A'. Wed May 02 16:34:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr199ala' Tue Jun 30 19:12:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr199Ala' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation avrp-pto-1 8 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction avrp-pto-2 1 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction avrp-pto-3 5 11 unspecified role unspecified role unspecified role unspecified role Q40234:p.[His49Glu;Val51Gly] H49E/V51G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V G certain certain sequence position certain certain certain sequence position certain H E This feature has been corrected as a result of our quality control procedures. The original label was 'H49E/V51G'. Wed May 02 15:10:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his49glu,val51gly' Tue Jun 30 18:57:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His49Glu;Val51Gly]' Q40234:p.[His49Glu;Val51Gly;Thr204Asn] H49E/V51G/T204N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V G certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'H49E/V51G/T204N'. Wed May 02 20:18:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his49glu,val51gly,thr204asn' Tue Jun 30 20:05:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His49Glu;Val51Gly;Thr204Asn]' Q40234:p.Thr204Asn T204N mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T204N'. Wed May 02 19:50:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr204asn' Tue Jun 30 17:42:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr204Asn' Q40234:p.[His49Glu;Val51Gly;Ile160Phe] H49E/V51G/I160F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V G certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain I F This feature has been corrected as a result of our quality control procedures. The original label was 'H49E/V51G/I160F'. Wed May 02 15:41:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his49glu,val51gly,ile160phe' Tue Jun 30 17:29:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His49Glu;Val51Gly;Ile160Phe]' Q40234:p.Ser226Asp S226D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S226D'. Wed May 02 16:55:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser226asp' Tue Jun 30 18:09:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser226Asp' Q40234:p.Thr199Ala T199A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T199A'. Wed May 02 18:55:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr199ala' Tue Jun 30 19:24:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr199Ala' Q40234:p.Leu205Asp L205D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L205D'. Wed May 02 19:28:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu205asp' Tue Jun 30 16:01:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu205Asp' Q40234:p.Arg163Ala R163A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R163A'. Wed May 02 17:30:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg163ala' Tue Jun 30 19:30:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg163Ala' ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pto-1 2 11 putative self putative self unspecified role unspecified role Q40234:p.Thr199Ala T199A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T199A'. Wed May 02 14:49:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr199ala' Tue Jun 30 17:51:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr199Ala' Q40234:p.Arg163Ala R163A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R163A'. Wed May 02 17:49:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg163ala' Tue Jun 30 19:25:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg163Ala' Q40234:p.Asp164Asn D164N mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D164N'. Wed May 02 16:16:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp164asn' Tue Jun 30 19:47:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp164Asn' Q40234:p.Leu205Asp L205D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L205D'. Wed May 02 19:06:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu205asp' Tue Jun 30 18:17:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu205Asp' Q40234:p.Val201Asp V201D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V D This feature has been corrected as a result of our quality control procedures. The original label was 'V201D'. Wed May 02 20:17:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val201asp' Tue Jun 30 17:37:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val201Asp' Q40234:p.Thr204Asn T204N mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T204N'. Wed May 02 20:14:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr204asn' Tue Jun 30 15:48:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr204Asn' Q40234:p.Ser226Asp S226D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S226D'. Wed May 02 15:41:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser226asp' Tue Jun 30 20:19:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser226Asp' Q40234:p.Lys202Asp K202D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K D This feature has been corrected as a result of our quality control procedures. The original label was 'K202D'. Wed May 02 18:44:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys202asp' Tue Jun 30 16:43:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys202Asp' Q40234:p.Gly203Asp G203D mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G203D'. Wed May 02 16:44:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly203asp' Tue Jun 30 17:17:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly203Asp' Q40234:p.Gly206Asp G206D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G206D'. Wed May 02 14:38:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly206asp' Tue Jun 30 18:04:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly206Asp' Q40234:p.Tyr207Asp Y207D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y D This feature has been corrected as a result of our quality control procedures. The original label was 'Y207D'. Wed May 02 15:07:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr207asp' Tue Jun 30 18:13:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr207Asp' Q40234:p.Ile208Asp I208D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I D This feature has been corrected as a result of our quality control procedures. The original label was 'I208D'. Wed May 02 20:22:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile208asp' Tue Jun 30 18:37:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile208Asp' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true avrp-pto-4 4 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 29-131 Region 29-131 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction avrp-pto-5 6 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pto-avrp-1 7 11 unspecified role unspecified role bait bait ecolx Escherichia coli 10 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction