DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260789X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113934X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113937X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260786X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260783X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113938X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113939X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260784X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113935X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260785X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113940X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260787X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-260788X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bisgrove DA., Mahmoudi T., Henklein P., Verdin E. DIP original experiment: DIP-113936X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription. cdk9_human Cyclin-dependent kinase 9 CDK9 CDC2L4 Cell division protein kinase 9 Serine/threonine-protein kinase PITALRE Cell division cycle 2-like protein kinase 4 C-2K TAK Tat-associated kinase complex catalytic subunit protein protein human Homo sapiens Human MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF DIP protein P50750 original sequence version: 100 DIP protein P50750 original sequence version: 115 DIP protein P50750-1 original sequence version: 119 DIP protein P50750 original sequence version: 170 DIP protein P50750 original sequence version: 184 DIP protein P50750-1 original sequence version: 144 DIP protein P50750 original sequence version: 70 DIP protein P50750 original sequence version: 120 69E851CC6F7A0388 ccnt1_human Cyclin-T1 CCNT1 protein protein human Homo sapiens Human MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSLNFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPPLPPLPK DIP protein O60563 original sequence version: 85 DIP protein O60563 original sequence version: 79 DIP protein O60563 original sequence version: 98 DIP protein O60563 original sequence version: 102 DIP protein O60563 original sequence version: 164 DIP protein O60563 original sequence version: 125 DIP protein O60563 original sequence version: 103 4637EFB2DDEDFE13 o60885-1 Bromodomain-containing protein 4 Brd4L Long BRD4 HUNK1 Protein HUNK1 protein protein human Homo sapiens Human MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF DIP protein O60885-1 original sequence version: 72 D52EFE1CF9960907 brd4-ccnt1-1 2 16 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association brd4-ccnt1-2 7 16 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait O60885-1:p.Arg1337Pro R1337P mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain R P This feature has been corrected as a result of our quality control procedures. The original label was 'R1337P'. Wed May 02 15:43:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1337pro' Tue Jun 30 18:30:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1337Pro' flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association brd4-cdk9-1 3 15 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait O60885-1:p.Arg1337Pro R1337P mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain R P This feature has been corrected as a result of our quality control procedures. The original label was 'R1337P'. Wed May 02 15:55:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1337pro' Tue Jun 30 17:13:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1337Pro' flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association brd4-cdk9-2 9 15 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait 722-1362 722-1362 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association brd4-cdk9-3 11 15 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1209-1362 1209-1362 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction brd4-ccnt1-3 6 16 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1209-1362 1209-1362 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction brd4-cdk9-4 14 15 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait deletion 1329-1362, 1329-1345, 1345-1362 deletion 1329-1362, 1329-1345, 1345-1362 required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association brd4-ccnt1-4 5 16 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association 1 nodeMerge04 2014-06-25 brd4-ccnt1-5 8 16 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait O60885-1:p.Arg1337Pro R1337P mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain R P This feature has been corrected as a result of our quality control procedures. The original label was 'R1337P'. Wed May 02 16:46:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1337pro' Tue Jun 30 19:22:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1337Pro' flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association 1 nodeMerge04 2014-06-25 brd4-ccnt1-6 10 16 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1209-1362 1209-1362 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction 1 nodeMerge04 2014-06-25 brd4-cdk9-5 4 15 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait deletion 1329-1362, 1329-1345, 1345-1362 deletion 1329-1362, 1329-1345, 1345-1362 required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association 1 nodeMerge04 2014-06-25 brd4-cdk9-6 12 15 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait O60885-1:p.Arg1337Pro R1337P mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain R P This feature has been corrected as a result of our quality control procedures. The original label was 'R1337P'. Wed May 02 14:25:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1337pro' Tue Jun 30 19:26:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1337Pro' flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association 1 nodeMerge04 2014-06-25 brd4-cdk9-7 13 15 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait 722-1362 722-1362 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association 1 nodeMerge04 2014-06-25 brd4-cdk9-8 1 15 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1209-1362 1209-1362 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction 1 nodeMerge04 2014-06-25