DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The refined structure of nascent HDL reveals a key functional domain for particle maturation and dysfunction. The refined structure of nascent HDL reveals a key functional domain for particle maturation and dysfunction. Nature structural & molecular biology 2007 imex curation Wu Z., Wagner MA., Zheng L., Parks JS., Shy JM., Smith JD., Gogonea V., Hazen SL. Only protein-protein interactions in vitro In vitro bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Wu Z., Wagner MA., Zheng L., Parks JS., Shy JM., Smith JD., Gogonea V., Hazen SL. DIP original experiment: DIP-68090X Nature structural & molecular biology 2007 IMEx The refined structure of nascent HDL reveals a key functional domain for particle maturation and dysfunction. The refined structure of nascent HDL reveals a key functional domain for particle maturation and dysfunction. The refined structure of nascent HDL reveals a key functional domain for particle maturation and dysfunction. Nature structural & molecular biology 2007 imex curation Wu Z., Wagner MA., Zheng L., Parks JS., Shy JM., Smith JD., Gogonea V., Hazen SL. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Wu Z., Wagner MA., Zheng L., Parks JS., Shy JM., Smith JD., Gogonea V., Hazen SL. DIP original experiment: DIP-68091X Nature structural & molecular biology 2007 IMEx The refined structure of nascent HDL reveals a key functional domain for particle maturation and dysfunction. apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ DIP protein P02647 original sequence version: 116 DIP protein P02647 original sequence version: 125 DIP protein P02647 original sequence version: 147 DIP protein P02647 original sequence version: 162 1A28B8366E620310 lcat_human Phosphatidylcholine-sterol acyltransferase LCAT Lecithin-cholesterol acyltransferase Phospholipid-cholesterol acyltransferase 1-alkyl-2-acetylglycerophosphocholine esterase Platelet-activating factor acetylhydrolase protein protein human Homo sapiens Human MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTYIYDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAILLGAYRQGPPASPTASPEPPPPE DIP protein P04180 original sequence version: 91 B315EF118AA7A378 apoa1-1 1 3 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction apoa1-lcat-2 2 4 unspecified role unspecified role neutral component neutral component crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 3 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction