DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. DIP original experiment: DIP-261772X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. DIP original experiment: DIP-261775X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. DIP original experiment: DIP-261773X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined White JF., Grodnitzky J., Louis JM., Trinh LB., Shiloach J., Gutierrez J., Northup JK., Grisshammer R. DIP original experiment: DIP-261774X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Dimerization of the class A G protein-coupled neurotensin receptor NTS1 alters G protein interaction. neut_human Neurotensin/neuromedin N NTS protein protein human Homo sapiens Human MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY DIP protein P30990 original sequence version: 112 66E2E146DA08E3C7 ntr1_human Neurotensin receptor type 1 NTSR1 NTRR High-affinity levocabastine-insensitive neurotensin receptor NTRH protein protein human Homo sapiens Human MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHSTFSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKADSVSSNHTLSSNATRETLY DIP protein P30989 original sequence version: 136 471AD1C49D29C2C8 nts-ntsr1-1 2 5 unspecified role unspecified role unspecified role unspecified role Region 151-163 Region 151-163 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nts-ntsr1-2 1 5 unspecified role unspecified role unspecified role unspecified role Region 151-163 Region 151-163 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ntsr1-1 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ntsr1-2 4 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction