DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Packing contacts can mediate highly specific interactions between artificial transmembrane proteins and the PDGFbeta receptor. Packing contacts can mediate highly specific interactions between artificial transmembrane proteins and the PDGFbeta receptor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ptacek JB., Edwards AP., Freeman-Cook LL., DiMaio D. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ptacek JB., Edwards AP., Freeman-Cook LL., DiMaio D. DIP original experiment: DIP-261768X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Packing contacts can mediate highly specific interactions between artificial transmembrane proteins and the PDGFbeta receptor. Packing contacts can mediate highly specific interactions between artificial transmembrane proteins and the PDGFbeta receptor. Packing contacts can mediate highly specific interactions between artificial transmembrane proteins and the PDGFbeta receptor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ptacek JB., Edwards AP., Freeman-Cook LL., DiMaio D. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ptacek JB., Edwards AP., Freeman-Cook LL., DiMaio D. DIP original experiment: DIP-261767X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Packing contacts can mediate highly specific interactions between artificial transmembrane proteins and the PDGFbeta receptor. pgfrb_mouse Platelet-derived growth factor receptor beta CD140 antigen-like family member B Pdgfrb Pdgfr Beta-type platelet-derived growth factor receptor Pdgfr1 Platelet-derived growth factor receptor 1 Beta platelet-derived growth factor receptor protein protein mouse Mus musculus Mouse MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMDMSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQPQDSGCPGPLAEAEDSFL DIP protein P05622 original sequence version: 166 DIP protein P05622 original sequence version: 148 D08FC7C42B77B794 c5iau5_9papi E5 protein protein bovine papillomavirus Bovine papillomavirus MPNLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF DIP protein C5IAU5 original sequence version: 5 e5-pdgfrb-2 2 4 unspecified role unspecified role bait bait mouse Mus musculus Mouse 3 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association pdgfrb-e5-1 1 4 unspecified role unspecified role prey prey mouse Mus musculus Mouse 3 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association