DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction of a plant virus-encoded protein with the major nucleolar protein fibrillarin is required for systemic virus infection. Interaction of a plant virus-encoded protein with the major nucleolar protein fibrillarin is required for systemic virus infection. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Kim SH., Macfarlane S., Kalinina NO., Rakitina DV., Ryabov EV., Gillespie T., Haupt S., Brown JW., Taliansky M. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Kim SH., Macfarlane S., Kalinina NO., Rakitina DV., Ryabov EV., Gillespie T., Haupt S., Brown JW., Taliansky M. DIP original experiment: DIP-261642X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Interaction of a plant virus-encoded protein with the major nucleolar protein fibrillarin is required for systemic virus infection. fbrl2_arath rRNA 2'-O-methyltransferase fibrillarin 2 FIB2 FLP Fibrillarin-like protein 2 Histone-glutamine methyltransferase MED36A MED36_1 L73G19.10 At4g25630 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPPLTGSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGGMKGGSKVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKTEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKSGGHFVISIKANCIDSTVPAEAVFQTEVKKLQQEQFKPAEQVTLEPFERDHACVVGGYRMPKKPKAATAA DIP protein Q94AH9 original sequence version: 65 0E3DF1733F52CFDC orf3_grvmc Long-distance movement protein ORF3 ORF3 protein protein protein grvmc Groundnut rosette virus (strain MC1) GRV MDTTPASRGQWPVGIMSSVINVFASGKSCNSGGAPRSSVRRGHRAGAARDKSRGFDAPPRRPKGGVHPATTSKDPNKDIRGPPAPTPHKKYRGPAIPGEGRSGVHTTRPRRRAGRSGGMDPRQLVAQPQQRWAKTEIPTERRAEIDGLLPSLLNTLDGQIQGDAALLRYCVGAIKRELRRRWESVQPAHHVAASSGKPSPQLFNEAAQNAEDLSGDGKGCAGQSVQQEVLHSGSGVPPVCADCGKPAANKW DIP protein Q67684 original sequence version: 32 med36a-orf3-1 1 2 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 3 unspecified role unspecified role prey prey Q67684:p.Leu149Ala L149A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L149A'. Wed May 02 20:24:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu149ala' Tue Jun 30 20:06:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu149Ala' nicbe Nicotiana benthamiana direct interaction direct interaction