DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261612X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261620X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261613X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261611X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261614X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261616X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261618X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261615X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261621X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261609X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261619X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261617X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mishima M., Maesaki R., Kasa M., Watanabe T., Fukata M., Kaibuchi K., Hakoshima T. DIP original experiment: DIP-261610X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. mare3_human Microtubule-associated protein RP/EB family member 3 End-binding protein 3 EB1 protein family member 3 RP3 MAPRE3 protein protein human Homo sapiens Human MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY DIP protein Q9UPY8 original sequence version: 128 DIP protein Q9UPY8-1 original sequence version: 109 0DA45E89A0B993D3 dctn1_human Dynactin subunit 1 DCTN1 150 kDa dynein-associated polypeptide DAP-150 p150-glued p135 protein protein human Homo sapiens Human MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS DIP protein Q14203 original sequence version: null DIP protein Q14203 original sequence version: 143 DIP protein Q14203 original sequence version: 135 DIP protein Q14203 original sequence version: 140 DIP protein Q14203-1 original sequence version: 146 DIP protein Q14203-1 original sequence version: 112 6DCEA5E67856E4BC tba8_human Tubulin alpha-8 chain TUBA8 TUBAL2 Alpha-tubulin 8 Tubulin alpha chain-like 2 protein protein human Homo sapiens Human MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLDRIRKLTDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNSQMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSFEEENEGEEF DIP protein Q9NY65 original sequence version: 125 8D1AFB9D131529BD p30622-2 CAP-Gly domain-containing linker protein 1 Short CLIP1 CYLN1 RSN Cytoplasmic linker protein 1 Cytoplasmic linker protein 170 alpha-2 Reed-Sternberg intermediate filament-associated protein Restin protein protein human Homo sapiens Human MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQAEDEANGLQTTPASRATSPLCTSTASMVSSSPSTPSNIPQKPSQPAAKEPSATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAADREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAGDVDMSLSLLQEISSLQEKLEVTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSKENESLKSKLEHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGLGTETAEFAELKTQIEKMRLDYQHEIENLQNQQDSERAAHAKEMEALRAKLMKVIKEKENSLEAIRSKLDKAEDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATEEKLLDLDALRKASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITRELQGRELKLTNLQENLSEVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRENLADMEAKFREKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEELQLKLTKANENASFLQKSIEDMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHNQCQELKARYERATSETKTKHEEILQNLQKTLLDTEDKLKGAREENSGLLQELEELRKQADKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQNELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSRDEVTSHQKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLRGENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF DIP protein P30622-2 original sequence version: 148 959DF99064762A10 tbb5_human Tubulin beta chain TUBB Tubulin beta-5 chain TUBB5 OK/SW-cl.56 protein protein human Homo sapiens Human MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA DIP protein P07437 original sequence version: 170 1E6CD0A36773A103 mare1_human Microtubule-associated protein RP/EB family member 1 APC-binding protein EB1 End-binding protein 1 MAPRE1 protein protein human Homo sapiens Human MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY DIP protein Q15691 original sequence version: 154 DIP protein Q15691 original sequence version: 151 DIP protein Q15691 original sequence version: 143 DIP protein Q15691 original sequence version: 84 08C8999F45A145ED tba3c_human Tubulin alpha-3C/D chain TUBA3C TUBA3D TUBA2 Alpha-tubulin 3C/D Tubulin alpha-2 chain Alpha-tubulin 2 protein protein human Homo sapiens Human MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSVEAEAEEGEEY DIP protein Q13748 original sequence version: 145 2A78714CBA782D55 tba1a_human Tubulin alpha-1A chain TUBA1A Tubulin B-alpha-1 Tubulin alpha-3 chain Alpha-tubulin 3 TUBA3 protein protein human Homo sapiens Human MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY DIP protein Q71U36 original sequence version: 111 00F8429A4A10E5FE tbb1_human Tubulin beta-1 chain TUBB1 protein protein human Homo sapiens Human MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH DIP protein Q9H4B7 original sequence version: 109 6A3E5208C1C89AE4 tbb3_human Tubulin beta-3 chain TUBB3 TUBB4 Tubulin beta-III Tubulin beta-4 chain protein protein human Homo sapiens Human MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK DIP protein Q13509 original sequence version: 137 4B9CDE7DBA102949 clip1-mapre1-3 12 19 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role bait bait P30622-2:p.Lys224Ala K224A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K224A'. Wed May 02 20:28:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys224ala' Tue Jun 30 16:11:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys224Ala' P30622-2:p.Lys252Ala K252A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K252A'. Wed May 02 14:26:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys252ala' Tue Jun 30 17:01:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys252Ala' P30622-2:p.Lys277Ala K277A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K277A'. Wed May 02 15:07:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys277ala' Tue Jun 30 18:24:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys277Ala' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tuba3c-clip1-1 10 20 unspecified role unspecified role bait bait Region 427-450 Region 427-450 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P30622-2:p.Lys224Ala K224A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K224A'. Wed May 02 19:40:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys224ala' Tue Jun 30 19:44:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys224Ala' P30622-2:p.Lys252Ala K252A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K252A'. Wed May 02 20:08:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys252ala' Tue Jun 30 15:49:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys252Ala' P30622-2:p.Lys277Ala K277A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K277A'. Wed May 02 18:39:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys277ala' Tue Jun 30 18:57:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys277Ala' ecolx Escherichia coli direct interaction direct interaction tuba1a-clip1-1 9 21 unspecified role unspecified role bait bait Region 427-451 Region 427-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P30622-2:p.Asn253Ala N253A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N253A'. Wed May 02 16:23:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn253ala' Tue Jun 30 20:22:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn253Ala' P30622-2:p.Asn253Asp N253D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain N D This feature has been corrected as a result of our quality control procedures. The original label was 'N253D'. Wed May 02 18:17:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn253asp' Tue Jun 30 15:38:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn253Asp' ecolx Escherichia coli direct interaction direct interaction tubb-clip1-1 3 18 unspecified role unspecified role bait bait Region 423-444 Region 423-444 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tubb1-clip1-1 7 22 unspecified role unspecified role bait bait Region 427-451 Region 427-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tuba1a-clip1-2 13 21 unspecified role unspecified role bait bait Region 427-451 Region 427-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mapre1-clip1-1 5 19 unspecified role unspecified role bait bait Region 244-268 Region 244-268 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tubb3-clip1-1 11 23 unspecified role unspecified role bait bait Region 427-450 Region 427-450 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tuba8-clip1-1 4 16 unspecified role unspecified role bait bait Region 427-449 Region 427-449 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mapre3-clip1-1 8 14 unspecified role unspecified role bait bait Region 253-281 Region 253-281 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tuba3c-dctn1-1 2 15 unspecified role unspecified role prey prey Region 20-102 Region 20-102 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role bait bait Region 427-450 Region 427-450 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction clip1-tuba1a-1 1 21 unspecified role unspecified role unspecified role unspecified role Region 416-451 Region 416-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mapre1-clip1-2 6 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Region 203-300 Region 203-300 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction