IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions between Mei4, Rec114, and other proteins required for meiotic DNA double-strand break formation in Saccharomyces cerevisiae. Interactions between Mei4, Rec114, and other proteins required for meiotic DNA double-strand break formation in Saccharomyces cerevisiae. Chromosoma 2007 imex curation Maleki S., Neale MJ., Arora C., Henderson KA., Keeney S. s-keeney@ski.mskcc.org 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maleki S., Neale MJ., Arora C., Henderson KA., Keeney S. Fig 6: I have added Role as Ancillary if there is a large/total reduction in signal on deletion of a molecule, otherwise I have added a comment only, unless the interaction is greatly increased on deletion - added as inhibitor. Yeast strains used carry the ndt80 mutation, which causes arrest of cells in prophase of meiosis I. s-keeney@ski.mskcc.org Accepted 2018-JAN-02 AT 12:13 GMT AT 12:13 GMT by ORCHARD Chromosoma 2007 imex curation re104_yeast Meiotic recombination protein REC104 REC104 YHR157W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIEEEDTNKITCTQDFLHQYFVTERVSIQFGLNNKTVKRINKDEFDKAVNCIMSWTNYPKPGLKRTASTYLLSNSFKKSATVSLPFILGDPVCMPKRVESNNNDTCLLYSDTLYDDPLIQRNDQAGDEIEDEFSFTLLRSEVNEIRPISSSSTAQILQSDYSALMYERQASNGSIFQFSSP spo11_yeast Meiosis-specific protein SPO11 SPO11 Sporulation-specific protein 11 YHL022C protein protein yeast Saccharomyces cerevisiae Baker's yeast MALEGLRKKYKTRQELVKALTPKRRSIHLNSNGHSNGTPCSNADVLAHIKHFLSLAANSLEQHQQPISIVFQNKKKKGDTSSPDIHTTLDFPLNGPHLCTHQFKLKRCAILLNLLKVVMEKLPLGKNTTVRDIFYSNVELFQRQANVVQWLDVIRFNFKLSPRKSLNIIPAQKGLVYSPFPIDIYDNILTCENEPKMQKQTIFPGKPCLIPFFQDDAVIKLGTTSMCNIVIVEKEAVFTKLVNNYHKLSTNTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFTDADPYGISIALNYTHSNERNAYICTMANYKGIRITQVLAQNNEVHNKSIQLLSLNQRDYSLAKNLIASLTANSWDIATSPLKNVIIECQREIFFQKKAEMNEIDARIFEYK FDDB079411DB3C71 ski8_yeast Antiviral protein SKI8 YGL213C SKI8 REC103 Superkiller protein 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFVHKSGLHHVDVLQAIERDAFELCLVATTSFSGDLLFYRITREDETKKVIFEKLDLLDSDMKKHSFWALKWGASNDRLLSHRLVATDVKGTTYIWKFHPFADESNSLTLNWSPTLELQGTVESPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDVKFLKKGWRSGMGADLNESLCCVCLDRSIRWFREAGGK C5E7B9D2268F9727 C5E7B9D2268F9727 re107_yeast Recombination protein 107 MER2 J1462 YJR021C REC107 Meiotic recombination protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAGKLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIENQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQEMLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTLLHDMDEAHDKQRKKSVPPPRMMVTRSMKRRRSSSPTLSTSQNHNSEDNDDASHRLKRAARTIIPWEELRPDTLESEL 46F426AC0DFDFAD0 46F426AC0DFDFAD0 mei4_yeast Meiosis-specific protein MEI4 MEI4 YER044BC YER044C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRGKLEDMEQKETSEVDWIICFALIQSRNPTLWKRALSRKKGDVEDVGALKSEKNLKINPRENSKHIYKWVAPFENGFLNNKSLFAHLEPIYNFLCQNKYKSFEDAVGLKELQSFSKDVSTADINNWFLPRYKILLKILSLKTKEIDFRGLSQVFQTLQILLVSHYSHRIDSDSSFKRTLIDVHVFNFIAKFLFNRILLKKNQNDPKWLQNFYDQGDGKHLCDKVDYKRLCSLHFTLIYSIINIQLIKIKTNQTFEPQILKYVSVLKLIEHILIIIESLIHVLIRFVSKHKLICINRKKAYCRVYLERELSLKKTYLKNFYSVISGVPEKELGGLLKILKIVILSLLETFESIEWQHLKPFLEKFPAHEISLQKKRKYIQAALLITAERNLIARFRLSRWFNETENI 86CE544E7567FDD6 to6bl_yeast Meiotic recombination protein REC102 L8543.17 YLR329W REC102 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARDITFLTVFLESCGAVNNDEAGKLLSAWTSTVRIEGPESTDSNSLYIPLLPPGMLKIKLNFKMNDRLVTEEQELFTKLREIVGSSIRFWEEQLFYQVQDVSTIENHVILSLKCTILTDAQISTFISKPRELHTHAKGYPEIYYLSELSTTVNFFSKEGNYVEISQVIPHFNEYFSSLIVSQLEFEYPMVFSMISRLRLKWQQSSLAPISYALTSNSVLLPIMLNMIAQDKSSTTAYQILCRRRGPPIQNFQIFSLPAVTYNK 0C332BFD12881126 re114_yeast Meiotic recombination protein REC114 YM9375.02 YMR133W REC114 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYEYCSVVIKKYSKYTIPSFAPNGFQSMLEPPQIDKWQHLSANCTLQFRVLLMDSRQILINVVLNNSTLLENIRLPLGDNQDLIQFSCKSPIISCKYISEEFGPRMLRRFQMNLPNDVEFNRTVVSLKNLNFVLRTARTSIAQSTITSQVQGNNNGTKVCFTEGPKVSSYTNPNTQFQTQNMIMDFSQRYQEESERESNNRSNITLPHDSIQIAQQIWPNTDLNVVQSSQDLNTPMATQTVLGRPESLIVQPLEVSQSPPNTTNCLPNAENKKKKVDTTSDFTSRKEIALCKTGLLETIHIPKERESQMQSVTGLDATPTIIWSPGKDNTAKKNTSNKKNIDDKLTNPQKSGNTHTPDRNKEVLPNGTLNETRKEASPSEGLTIRVKNVNRNASRKISKRLIKEKLKDEEFMKWVNKVETVLNKMFEK 57CB835DA71FBA9B mei4-rec114-3 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 4A mei4-rec114-4 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 4C Both the N-terminal and C-terminal regions of Rec114 are sufficient by themselves to support interaction with Mei4. both the N-terminal and C-terminal regions of Rec114 are sufficient by themselves to support interaction with Mei4 mei4-rec114-5 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 5F rec102-rec114-1 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 5E rec102-rec104-1 1 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Figure 5Ei rec104-rec102-1 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 2 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6A spo11-rec102-1 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6B spo11-rec104-1 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6C ski8-rec104-1 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 3 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6C-2 The signal was reduced ∼2.5-fold in the Delta_rec114 strain. spo11-rec104-2 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6D mei4-rec102-1 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 5 inhibitor inhibitor unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6D-2 Deletion of spo11 and rec104 reduced this interaction. mei4-rec102-2 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 5 inhibitor inhibitor unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6E-4 mei4-rec102-3 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6E-3 mei4-rec104-1 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6E-1 mei4-rec104-2 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 3 unspecified role unspecified role ancillary ancillary physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6E-2 mei4-rec114-6 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 6F Mer2 still interacted with Rec114 in a mei4-delta strain, although with a LacZ signal reduced ∼ 2-fold. Similar two-hybrid signals were obtained in each of the other mutants tested, notably deletions of :- rec102, spo11 and rec104.