DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex. Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Williams JC., Roulhac PL., Roy AG., Vallee RB., Fitzgerald MC., Hendrickson WA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Williams JC., Roulhac PL., Roy AG., Vallee RB., Fitzgerald MC., Hendrickson WA. DIP original experiment: DIP-261601X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex. Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex. Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Williams JC., Roulhac PL., Roy AG., Vallee RB., Fitzgerald MC., Hendrickson WA. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Williams JC., Roulhac PL., Roy AG., Vallee RB., Fitzgerald MC., Hendrickson WA. DIP original experiment: DIP-261602X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex. dyl1_drome Dynein light chain 1, cytoplasmic ctp Cdlc1 ddlc1 CG6998 8 kDa dynein light chain Cut up protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG DIP protein Q24117 original sequence version: 113 44871BC030423A8F dc1i2_rat Cytoplasmic dynein 1 intermediate chain 2 Dync1i2 Dnci2 Dncic2 Cytoplasmic dynein intermediate chain 2 Dynein intermediate chain 2, cytosolic protein protein rat Rattus norvegicus (Rat) Rat MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAAVSVQEESDLEKKRREAEALLQSMGLTTDSPIVFSEHWVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLHWDTDPSALQLHSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVTAQPKEDEEEEDDVAAPKPPVEPEEEKILKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWSTKNNKPLYSFEDNSDYVYDVIGSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINASRADAEEEAATRIPA DIP protein Q62871 original sequence version: 107 0A655543CE266E95 dylt_drome Dynein light chain Tctex-type Dlc90F Tctex CG12363 TCTEX-1 protein homolog protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV DIP protein Q94524 original sequence version: 103 544CC39F5B318137 ctp-dlc90f-2 1 4 unspecified role unspecified role unspecified role unspecified role Region 132-164 Region 132-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ctp-dlc90f-3 2 4 unspecified role unspecified role unspecified role unspecified role Region 132-164 Region 132-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association