DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Bone morphogenetic protein 1 processes prolactin to a 17-kDa antiangiogenic factor. Bone morphogenetic protein 1 processes prolactin to a 17-kDa antiangiogenic factor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ge G., Fernández CA., Moses MA., Greenspan DS. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ge G., Fernández CA., Moses MA., Greenspan DS. DIP original experiment: DIP-261598X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bone morphogenetic protein 1 processes prolactin to a 17-kDa antiangiogenic factor. Bone morphogenetic protein 1 processes prolactin to a 17-kDa antiangiogenic factor. Bone morphogenetic protein 1 processes prolactin to a 17-kDa antiangiogenic factor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ge G., Fernández CA., Moses MA., Greenspan DS. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ge G., Fernández CA., Moses MA., Greenspan DS. DIP original experiment: DIP-261597X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bone morphogenetic protein 1 processes prolactin to a 17-kDa antiangiogenic factor. bmp1_human Bone morphogenetic protein 1 Procollagen C-proteinase Mammalian tolloid protein BMP1 PCOLC protein protein human Homo sapiens Human MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKFQDTLHSRK DIP protein P13497 original sequence version: 166 DIP protein P13497-1 original sequence version: 130 F89201913AC3CBEA prl_human Prolactin PRL protein protein human Homo sapiens Human MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC DIP protein P01236 original sequence version: 150 DIP protein P01236 original sequence version: 127 952BBA1B6A955527 soma_human Somatotropin GH1 Growth hormone Pituitary growth hormone Growth hormone 1 protein protein human Homo sapiens Human MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF DIP protein P01241 original sequence version: 176 72CC15AF4ED1C51A prl-bmp1-1 2 4 unspecified role unspecified role bait bait ecolx Escherichia coli 3 unspecified role unspecified role prey prey P13497:p.Glu214Ala E214A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E214A'. Wed May 02 16:44:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu214ala' Tue Jun 30 18:41:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu214Ala' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association gh1-bmp1-1 1 5 unspecified role unspecified role bait bait ecolx Escherichia coli 3 unspecified role unspecified role prey prey P13497:p.Glu214Ala E214A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E214A'. Wed May 02 16:32:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu214ala' Tue Jun 30 16:48:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu214Ala' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association