DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Nature structural & molecular biology 2007 imex curation Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. DIP original experiment: DIP-66824X Nature structural & molecular biology 2007 IMEx Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Nature structural & molecular biology 2007 imex curation Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. DIP original experiment: DIP-66822X Nature structural & molecular biology 2007 IMEx Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Nature structural & molecular biology 2007 imex curation Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. DIP original experiment: DIP-66820X Nature structural & molecular biology 2007 IMEx Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Nature structural & molecular biology 2007 imex curation Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. DIP original experiment: DIP-66825X Nature structural & molecular biology 2007 IMEx Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Nature structural & molecular biology 2007 imex curation Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. DIP original experiment: DIP-253201X Nature structural & molecular biology 2007 IMEx Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Nature structural & molecular biology 2007 imex curation Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. DIP original experiment: DIP-66823X Nature structural & molecular biology 2007 IMEx Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Nature structural & molecular biology 2007 imex curation Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. DIP original experiment: DIP-66826X Nature structural & molecular biology 2007 IMEx Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. Nature structural & molecular biology 2007 imex curation Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen Y., Xu Y., Bao Q., Xing Y., Li Z., Lin Z., Stock JB., Jeffrey PD., Shi Y. DIP original experiment: DIP-66821X Nature structural & molecular biology 2007 IMEx Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40. p2r3a_human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha PPP2R3A PPP2R3 Serine/threonine-protein phosphatase 2A 72/130 kDa regulatory subunit B PP2A subunit B isoforms B''-PR72/PR130 PP2A subunit B isoforms B72/B130 PP2A subunit B isoform PR72/PR130 PP2A subunit B isoform R3 isoform protein protein human Homo sapiens Human MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPVSQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFASGKIKEFSFEKLKNSNHAAYRKGRKVKSDSFNRRSVDLDLLCGHYNNDGNAPSFGLLRSSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLASYLKKLPFEFMQSGNNEALDLTELISNMPSLQLTPFSPVFGTEQPPKYEDVVQLSASDSGRFQTIELQNDKPNSRKMDTVQSIPNNSTNSLYNLEVNDPRTLKAVQVQSQSLTMNPLENVSSDDLMETLYIEEESDGKKALDKGQKTENGPSHELLKVNEHRAEFPEHATHLKKCPTPMQNEIGKIFEKSFVNLPKEDCKSKVSKFEEGDQRDFTNSSSQEEIDKLLMDLESFSQKMETSLREPLAKGKNSNFLNSHSQLTGQTLVDLEPKSKVSSPIEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIEDFAQELVECKSSRGSLSQEKEMMQILQETLTTSSQANLSVCRSPVGDKAKDTTSAVLIQQTPEVIKIQNKPEKKPGTPLPPPATSPSSPRPLSPVPHVNNVVNAPLSINIPRFYFPEGLPDTCSNHEQTLSRIETAFMDIEEQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVTAQSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE DIP protein Q06190 original sequence version: 138 DIP protein Q06190 original sequence version: 63 97A31BA4206518A3 2aba_human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform PPP2R2A PP2A subunit B isoform alpha PP2A subunit B isoform B55-alpha PP2A subunit B isoform PR55-alpha PP2A subunit B isoform R2-alpha protein protein human Homo sapiens Human MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN DIP protein P63151 original sequence version: 33 DIP protein P63151 original sequence version: 66 F4D407FF7ADA4ED6 st_sv40 Small t antigen protein protein sv40 sv40 SV40 MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEVFASSLNPGVDAMYCKQWPECAKKMSANCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDLKL 91EC925ED2E29668 91EC925ED2E29668 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA DIP protein P30153 original sequence version: 153 DIP protein P30153 original sequence version: 71 DIP protein P30153 original sequence version: 105 DIP protein P30153 original sequence version: 107 DIP protein P30153 original sequence version: 151 DIP protein P30153 original sequence version: 156 DIP protein P30153 original sequence version: 155 DIP protein P30153 original sequence version: 169 5174EBE94D537836 pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 q13362-2 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform PPP2R5C KIAA0044 PP2A B subunit isoform B'-gamma PP2A B subunit isoform B56-gamma PP2A B subunit isoform PR61-gamma PP2A B subunit isoform R5-gamma Renal carcinoma antigen NY-REN-29 protein protein human Homo sapiens Human MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQVLKKRIT DIP protein Q13362-2 original sequence version: 135 DIP protein Q13362-2 original sequence version: 64 73CE22E378289FE8 ppp2ca-ppp2r1a-12 7 9 unspecified role unspecified role neutral component neutral component 165-529 binding region 165-529 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 12 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction ppp2ca-ppp2r1a-13 2 13 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 12 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction ppp2r1a-st-2 8 12 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 11 unspecified role unspecified role neutral component neutral component 87-174 binding region 87-174 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ppp2ca-ppp2r1a-14 6 11 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 13 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 12 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association ppp2r1a-st-3 3 12 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 11 unspecified role unspecified role neutral component neutral component 87-174 binding region 87-174 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ppp2ca-ppp2r1a-15 1 14 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 13 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 12 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association ppp2ca-ppp2r1a-16 4 10 unspecified role unspecified role neutral component neutral component spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 12 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association ppp2ca-ppp2r1a-17 5 14 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 13 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 12 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association 1 nodeMerge04 2013-08-12