DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261489X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261487X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261485X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261488X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261486X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ji Y., Ferracci G., Warley A., Ward M., Leung KY., Samsuddin S., Lévêque C., Queen L., Reebye V., Pal P., Gkaliagkousi E., Seager M., Ferro A. DIP original experiment: DIP-261490X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx beta-Actin regulates platelet nitric oxide synthase 3 activity through interaction with heat shock protein 90. actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 nos3_human Nitric oxide synthase, endothelial Endothelial NOS EC-NOS NOS type III Constitutive NOS NOS3 protein protein human Homo sapiens Human MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDDPPELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAARDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATILVRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVLAYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDTNSP DIP protein P29474 original sequence version: 179 DIP protein P29474 original sequence version: 175 DIP protein P29474 original sequence version: 112 DIP protein P29474 original sequence version: 140 DIP protein P29474 original sequence version: 158 B761A6D40B1A5649 cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 nos3_bovin Nitric oxide synthase, endothelial NOS3 Endothelial NOS EC-NOS NOS type III Constitutive NOS protein protein bovin Bos taurus (Bovine) Bovine MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSRAPAPATPHAPDHSPAPNSPTLTRPPEGPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRCCLGSLVLPRKLQTRPSPGPPPAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIVDHHAATVSFMKHLDNEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRYQPDPWKGSATKGAGITRKKTFKEVANAVKISASLMGTLMAKRVKATILYASETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAKAAFQASCETFCVGEEAKAAAQDIFSPKRSWKRQRYRLSTQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRATILVRLDTAGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPTESVAVEQLEKGSPGGPPPSWVRDPRLPPCTLRQALTFFLDITSPPSPRLLRLLSTLAEEPSEQQELETLSQDPRRYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPNAHPGEVHLTVAVLAYRTQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPYVPCILVGPGTGIAPFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQERGVFGRVLTAFSREPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWAFDPPGPDTPGP DIP protein P29473 original sequence version: 163 DIP protein P29473 original sequence version: 109 mint Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. No mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets 5DC8FF4F25870281 nos3-actb-1 3 8 unspecified role unspecified role bait bait human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association nos3-cav1-1 4 8 unspecified role unspecified role bait bait human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association actb-nos3-1 5 10 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction actb-cav1-1 1 9 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association actb-nos3-2 2 8 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association nos3-actb-2 6 8 unspecified role unspecified role bait bait human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association