DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Selective adapter recruitment and differential signaling networks by VEGF vs. shear stress. Selective adapter recruitment and differential signaling networks by VEGF vs. shear stress. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wang Y., Chang J., Chen KD., Li S., Li JY., Wu C., Chien S. Only protein-protein interactions bovin Bos taurus (Bovine) Bovine anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Y., Chang J., Chen KD., Li S., Li JY., Wu C., Chien S. DIP original experiment: DIP-261476X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Selective adapter recruitment and differential signaling networks by VEGF vs. shear stress. q28197_bovin flk-1 protein protein bovin Bos taurus (Bovine) Bovine PNNQSSSEKRVEVTDCSDGVFCKMLTISEVIGNDTGAYKCFYQDTDMGSVLYVYVQDYRSPFIASVSDQHEVVYITENKNKTVVIPCLGTVSDLNVSLCARYPEKRFAPDGNRISWDSQKGFSIPSY DIP protein Q28197 original sequence version: 65 a6h720_bovin Cytoplasmic protein NCK2 protein protein bovin Bos taurus (Bovine) Bovine MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKNIKDTLGLGRTRRKTSARDASPTPSTDAEFPANGGGADRIYDLSIPAVVKFAYAAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQVGWFPSNYVLEELDEAAGDAPGGSSLRPGATLSNGQGARALQVVQTLYPFSSVTEEELNFDKGETMEVIEKPENDPEWWRCRNARGQVGLVPKNYVVVLSEGPAPHAGSGPAGPARAGRFAGREWYYGNVTRHQAECALNARGVQGDFLVRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYKKAPIFTSEHGEKLYLVRALQ DIP protein A6H720 original sequence version: 62 nck2-flk_1-1 1 2 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine 3 unspecified role unspecified role bait bait bovin Bos taurus (Bovine) Bovine physical association physical association