DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of RseB and a model of its binding mode to RseA. Crystal structure of RseB and a model of its binding mode to RseA. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Kim DY., Jin KS., Kwon E., Ree M., Kim KK. Only protein-protein interactions in vitro In vitro pull down pull down weight identificat confirmation by molecular weight weight identificat Kim DY., Jin KS., Kwon E., Ree M., Kim KK. DIP original experiment: DIP-261474X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of RseB and a model of its binding mode to RseA. Crystal structure of RseB and a model of its binding mode to RseA. Crystal structure of RseB and a model of its binding mode to RseA. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Kim DY., Jin KS., Kwon E., Ree M., Kim KK. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Kim DY., Jin KS., Kwon E., Ree M., Kim KK. DIP original experiment: DIP-261472X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of RseB and a model of its binding mode to RseA. Crystal structure of RseB and a model of its binding mode to RseA. Crystal structure of RseB and a model of its binding mode to RseA. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Kim DY., Jin KS., Kwon E., Ree M., Kim KK. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Kim DY., Jin KS., Kwon E., Ree M., Kim KK. DIP original experiment: DIP-261473X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of RseB and a model of its binding mode to RseA. Crystal structure of RseB and a model of its binding mode to RseA. Crystal structure of RseB and a model of its binding mode to RseA. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Kim DY., Jin KS., Kwon E., Ree M., Kim KK. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kim DY., Jin KS., Kwon E., Ree M., Kim KK. DIP original experiment: DIP-261475X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of RseB and a model of its binding mode to RseA. Crystal structure of RseB and a model of its binding mode to RseA. Crystal structure of RseB and a model of its binding mode to RseA. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Kim DY., Jin KS., Kwon E., Ree M., Kim KK. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kim DY., Jin KS., Kwon E., Ree M., Kim KK. DIP original experiment: DIP-261471X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Crystal structure of RseB and a model of its binding mode to RseA. rseb_ecoli Sigma-E factor regulatory protein RseB rseB b2571 JW2555 protein protein ecoli Escherichia coli (strain K12) MKQLWFAMSLVTGSLLFSANASATPASGALLQQMNLASQSLNYELSFISINKQGVESLRYRHARLDNRPLAQLLQMDGPRREVVQRGNEISYFEPGLEPFTLNGDYIVDSLPSLIYTDFKRLSPYYDFISVGRTRIADRLCEVIRVVARDGTRYSYIVWMDTESKLPMRVDLLDRDGETLEQFRVIAFNVNQDISSSMQTLAKANLPPLLSVPVGEKAKFSWTPTWLPQGFSEVSSSRRPLPTMDNMPIESRLYSDGLFSFSVNVNRATPSSTDQMLRTGRRTVSTSVRDNAEITIVGELPPQTAKRIAENIKFGAAQ DIP protein P0AFX9 original sequence version: 63 3F8C34DD85600B54 rsea_ecoli Anti-sigma-E factor RseA yfiJ rseA mclA b2572 JW2556 Regulator of SigE Sigma-E anti-sigma factor RseA Sigma-E factor negative regulatory protein protein protein ecoli Escherichia coli (strain K12) MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ DIP protein P0AFX7 original sequence version: 71 DIP protein P0AFX7 original sequence version: 40 DIP protein P0AFX7 original sequence version: 39 DIP protein P0AFX7 original sequence version: 76 63BD12131C611C32 rseb-1 5 6 unspecified role unspecified role unspecified role unspecified role Region 24-318 Region 24-318 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rsea-rseb-6 1 6 unspecified role unspecified role prey prey Region 24-318 Region 24-318 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role bait bait Region 169-186 Region 169-186 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P0AFX7:p.[Arg171Glu;Arg172Glu] R171E/R172E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R171E/R172E'. Wed May 02 19:20:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg171glu,arg172glu' Tue Jun 30 15:45:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg171Glu;Arg172Glu]' P0AFX7:p.[Arg184Glu;Arg185Glu] R184E/R185E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R184E/R185E'. Wed May 02 19:29:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg184glu,arg185glu' Tue Jun 30 18:26:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg184Glu;Arg185Glu]' P0AFX7:p.[Arg171Ala;Arg172Ala] R171A/R172A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R171A/R172A'. Wed May 02 15:42:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg171ala,arg172ala' Tue Jun 30 16:50:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg171Ala;Arg172Ala]' P0AFX7:p.[Arg184Ala;Arg185Ala] R184A/R185A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R184A/R185A'. Wed May 02 19:11:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg184ala,arg185ala' Tue Jun 30 16:30:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg184Ala;Arg185Ala]' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rseb-2 2 6 unspecified role unspecified role unspecified role unspecified role Region 24-318 Region 24-318 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rsea-rseb-7 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 24-318 Region 24-318 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rseb-3 4 6 unspecified role unspecified role unspecified role unspecified role Region 24-318 Region 24-318 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction