DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Redox-mediated substrate recognition by Sdp1 defines a new group of tyrosine phosphatases. Redox-mediated substrate recognition by Sdp1 defines a new group of tyrosine phosphatases. Nature 2007 imex curation Fox GC., Shafiq M., Briggs DC., Knowles PP., Collister M., Didmon MJ., Makrantoni V., Dickinson RJ., Hanrahan S., Totty N., Stark MJ., Keyse SM., McDonald NQ. Only protein-protein interactions in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Fox GC., Shafiq M., Briggs DC., Knowles PP., Collister M., Didmon MJ., Makrantoni V., Dickinson RJ., Hanrahan S., Totty N., Stark MJ., Keyse SM., McDonald NQ. DIP original experiment: DIP-253320X Nature 2007 IMEx Redox-mediated substrate recognition by Sdp1 defines a new group of tyrosine phosphatases. sdp1_yeast Dual-specificity protein phosphatase SDP1 YIL113W Stress-inducible MAPK phosphatase SDP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNIYTSPTRTPNIAPKSGQRPSLPMLATDERSTDKESPNEDREFVPCSSLDVRRIYPKGPLLVLPEKIYLYSEPTVKELLPFDVVINVAEEANDLRMQVPAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAKTNVQANSYRKVP 678371462A890A69 678371462A890A69 mk01_rat Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein rat Rattus norvegicus (Rat) Rat MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P63086 original sequence version: 127 DIP protein P63086 original sequence version: 1(def) DIP protein P63086 original sequence version: 36 DIP protein P63086 original sequence version: 112 DIP protein P63086 original sequence version: 92 DIP protein P63086 original sequence version: 84 DIP protein P63086 original sequence version: 100 3BBCF22471EDBA0B mapk1-sdp1-1 1 2 enzyme enzyme unspecified role unspecified role Region 46-197 Region 46-197 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P40479:p.Cys140Ser C140S mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C140S'. Wed May 02 14:37:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys140ser' Tue Jun 30 17:03:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys140Ser' P40479:p.Cys142Ser C142S/E mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:23:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys142ser' Tue Jun 30 18:34:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys142Ser' P40479:p.Cys142Met C142M mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C M This feature has been corrected as a result of our quality control procedures. The original label was 'C142M'. Wed May 02 16:46:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys142met' Tue Jun 30 19:07:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys142Met' P40479:p.Cys47Ser C47S mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C47S'. Wed May 02 20:07:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser' Tue Jun 30 18:26:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys47Ser' P40479:p.[Cys47Ser;Cys142Ser] C47S/C142S mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C47S/C142S'. Wed May 02 16:06:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys142ser' Tue Jun 30 17:58:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys47Ser;Cys142Ser]' P40479:p.His111Asn H111N mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H N This feature has been corrected as a result of our quality control procedures. The original label was 'H111N'. Wed May 02 16:47:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his111asn' Tue Jun 30 19:54:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His111Asn' P40479:p.Cys142Glu mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain C E Wed May 02 20:30:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys142glu' Tue Jun 30 17:31:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys142Glu' ecolx Escherichia coli 3 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation