DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of RNase T, an exoribonuclease involved in tRNA maturation and end turnover. Crystal structure of RNase T, an exoribonuclease involved in tRNA maturation and end turnover. Structure (London, England : 1993) 2007 imex curation Zuo Y., Zheng H., Wang Y., Chruszcz M., Cymborowski M., Skarina T., Savchenko A., Malhotra A., Minor W. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zuo Y., Zheng H., Wang Y., Chruszcz M., Cymborowski M., Skarina T., Savchenko A., Malhotra A., Minor W. DIP original experiment: DIP-66880X Structure (London, England : 1993) 2007 IMEx Crystal structure of RNase T, an exoribonuclease involved in tRNA maturation and end turnover. Crystal structure of RNase T, an exoribonuclease involved in tRNA maturation and end turnover. Crystal structure of RNase T, an exoribonuclease involved in tRNA maturation and end turnover. Structure (London, England : 1993) 2007 imex curation Zuo Y., Zheng H., Wang Y., Chruszcz M., Cymborowski M., Skarina T., Savchenko A., Malhotra A., Minor W. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zuo Y., Zheng H., Wang Y., Chruszcz M., Cymborowski M., Skarina T., Savchenko A., Malhotra A., Minor W. DIP original experiment: DIP-66881X Structure (London, England : 1993) 2007 IMEx Crystal structure of RNase T, an exoribonuclease involved in tRNA maturation and end turnover. rnt_ecoli Ribonuclease T Exoribonuclease T rnt b1652 JW1644 protein protein ecoli Escherichia coli (strain K12) MSDNAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV 502C1CCEFABF4B05 502C1CCEFABF4B05 rnt_pseae Ribonuclease T rnt Exoribonuclease T PA3528 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MSEDNFDDEFDGSLPSGPRHPMARRFRGYLPVVVDVETGGFNSATDALLEIAATTVGMDEKGFLFPEHTYFFRIEPFEGANIEPAALEFTGIKLDHPLRMAVQEEAALTEIFRGIRKALKANGCKRAILVGHNSSFDLGFLNAAVARTGIKRNPFHPFSSFDTATLAGLAYGQTVLAKACQAAGMEFDNREAHSARYDTEKTAELFCGIVNRWKEMGGWMDDDD CC1010D3AD60F442 prnase t-prnase t-1 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction crnase t-crnase t-1 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction