DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the human GINS complex and its assembly and functional interface in replication initiation. Structure of the human GINS complex and its assembly and functional interface in replication initiation. Nature structural & molecular biology 2007 imex curation Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F. DIP original experiment: DIP-66680X Nature structural & molecular biology 2007 IMEx Structure of the human GINS complex and its assembly and functional interface in replication initiation. Structure of the human GINS complex and its assembly and functional interface in replication initiation. Structure of the human GINS complex and its assembly and functional interface in replication initiation. Nature structural & molecular biology 2007 imex curation Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F. DIP original experiment: DIP-66682X Nature structural & molecular biology 2007 IMEx Structure of the human GINS complex and its assembly and functional interface in replication initiation. Structure of the human GINS complex and its assembly and functional interface in replication initiation. Structure of the human GINS complex and its assembly and functional interface in replication initiation. Nature structural & molecular biology 2007 imex curation Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F. DIP original experiment: DIP-66681X Nature structural & molecular biology 2007 IMEx Structure of the human GINS complex and its assembly and functional interface in replication initiation. psf2_human DNA replication complex GINS protein PSF2 GINS complex subunit 2 GINS2 CGI-122 DC5 HSPC037 PSF2 protein protein human Homo sapiens Human MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF DIP protein Q9Y248 original sequence version: 41 DIP protein Q9Y248 original sequence version: 58 4F6A18B1ED76F93C sld5_human DNA replication complex GINS protein SLD5 SLD5 GINS complex subunit 4 GINS4 protein protein human Homo sapiens Human MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI DIP protein Q9BRT9 original sequence version: 31 DIP protein Q9BRT9 original sequence version: 45 DIP protein Q9BRT9 original sequence version: 67 8FAB619A21968BB9 psf1_human DNA replication complex GINS protein PSF1 GINS1 GINS complex subunit 1 KIAA0186 PSF1 protein protein human Homo sapiens Human MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS DIP protein Q14691 original sequence version: 66 DIP protein Q14691 original sequence version: 80 2270B5CE6C43BFE5 psf3_human DNA replication complex GINS protein PSF3 GINS3 PSF3 GINS complex subunit 3 protein protein human Homo sapiens Human MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED DIP protein Q9BRX5 original sequence version: 31 DIP protein Q9BRX5 original sequence version: 48 DIP protein Q9BRX5 original sequence version: 66 A1B264A72371C551 gins1-gins2-1 1 5 unspecified role unspecified role neutral component neutral component 1-149 binding region 1-149 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association gins1-gins2-2 3 5 unspecified role unspecified role neutral component neutral component 1-149 binding region 1-149 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association gins1-gins2-3 2 5 unspecified role unspecified role neutral component neutral component 1-149 binding region 1-149 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association