DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for ligand and heparin binding to neuropilin B domains. Structural basis for ligand and heparin binding to neuropilin B domains. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Vander Kooi CW., Jusino MA., Perman B., Neau DB., Bellamy HD., Leahy DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Vander Kooi CW., Jusino MA., Perman B., Neau DB., Bellamy HD., Leahy DJ. DIP original experiment: DIP-261332X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for ligand and heparin binding to neuropilin B domains. Structural basis for ligand and heparin binding to neuropilin B domains. Structural basis for ligand and heparin binding to neuropilin B domains. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Vander Kooi CW., Jusino MA., Perman B., Neau DB., Bellamy HD., Leahy DJ. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Vander Kooi CW., Jusino MA., Perman B., Neau DB., Bellamy HD., Leahy DJ. DIP original experiment: DIP-261333X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for ligand and heparin binding to neuropilin B domains. Structural basis for ligand and heparin binding to neuropilin B domains. Structural basis for ligand and heparin binding to neuropilin B domains. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Vander Kooi CW., Jusino MA., Perman B., Neau DB., Bellamy HD., Leahy DJ. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Vander Kooi CW., Jusino MA., Perman B., Neau DB., Bellamy HD., Leahy DJ. DIP original experiment: DIP-261334X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for ligand and heparin binding to neuropilin B domains. nrp2_human Neuropilin-2 NRP2 VEGF165R2 Vascular endothelial cell growth factor 165 receptor 2 protein protein human Homo sapiens Human MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPTEEEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQIVFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNSSSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLENYNFELYDGLKHKVKMNHQKCCSEA DIP protein O60462 original sequence version: 133 DIP protein O60462 original sequence version: 142 270CBAE69A0A797C nrp1_rat Neuropilin-1 Nrp1 Vascular endothelial cell growth factor 165 receptor protein protein rat Rattus norvegicus (Rat) Rat MERGLPLLCATLALALALAGAFRSDKCGGTIKIENPGYLTSPGYPHSYHPSEKCEWLIQAPEPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENEGGRLWGKFCGKIAPSPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTAPTGVIKSPGFPEKYPNSLECTYIIFAPKMSEIILEFESFDLEQDSNPPGGVFCRYDRLEIWDGFPEVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSISEDFKCMEALGMESGEIHSDQITASSQYGTNWSVERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYRVDISSNGEDWITLKEGNKAIIFQGNTNPTDVVFGVFPKPLITRFVRIKPASWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITASNQGDRNWMPENIRLVTSRTGWALPPSPHPYINEWLQVDLGDEKIVRGVIIQGGKHRENKVFMRKFKIAYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRAFTPLSTRFIRIYPERATHSGLGLRMELLGCEVEVPTAGPTTPNGNPVDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTIIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDSHAQLRWRVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQSSAHCMTFWYHMSGSHVGTLRVKLHYQKPEEYDQLVWMVVGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHIPQEDCAKPTDLDKKNTEIKIDETGSTPGYEEGKGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNPQSNYSEA DIP protein Q9QWJ9 original sequence version: 119 CC6F82AD098B0F2E vegfa_human Vascular endothelial growth factor A Vascular permeability factor VEGFA VEGF protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR DIP protein P15692 original sequence version: 190 DIP protein P15692 original sequence version: 150 FB49F364446F4D01 nrp2-1 3 4 unspecified role unspecified role unspecified role unspecified role Region 276-595 Region 276-595 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nrp1-vegfa-2 1 6 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait Q9QWJ9:p.Glu348Ala E348A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E348A'. Wed May 02 19:50:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu348ala' Tue Jun 30 20:18:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu348Ala' Q9QWJ9:p.Ser346Ala S346A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S346A'. Wed May 02 14:37:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser346ala' Tue Jun 30 19:08:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser346Ala' Q9QWJ9:p.Thr349Ala T349A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T349A'. Wed May 02 18:58:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr349ala' Tue Jun 30 19:42:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr349Ala' Region 273-585 Region 273-585 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction nrp1-1 2 5 unspecified role unspecified role unspecified role unspecified role Region 273-585 Region 273-585 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction