DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Elucidating the ticking of an in vitro circadian clockwork. Elucidating the ticking of an in vitro circadian clockwork. PLoS biology 2007 imex curation Mori T., Williams DR., Byrne MO., Qin X., Egli M., Mchaourab HS., Stewart PL., Johnson CH. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Mori T., Williams DR., Byrne MO., Qin X., Egli M., Mchaourab HS., Stewart PL., Johnson CH. DIP original experiment: DIP-66720X PLoS biology 2007 IMEx Elucidating the ticking of an in vitro circadian clockwork. Elucidating the ticking of an in vitro circadian clockwork. Elucidating the ticking of an in vitro circadian clockwork. PLoS biology 2007 imex curation Mori T., Williams DR., Byrne MO., Qin X., Egli M., Mchaourab HS., Stewart PL., Johnson CH. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Mori T., Williams DR., Byrne MO., Qin X., Egli M., Mchaourab HS., Stewart PL., Johnson CH. DIP original experiment: DIP-66718X PLoS biology 2007 IMEx Elucidating the ticking of an in vitro circadian clockwork. Elucidating the ticking of an in vitro circadian clockwork. Elucidating the ticking of an in vitro circadian clockwork. PLoS biology 2007 imex curation Mori T., Williams DR., Byrne MO., Qin X., Egli M., Mchaourab HS., Stewart PL., Johnson CH. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Mori T., Williams DR., Byrne MO., Qin X., Egli M., Mchaourab HS., Stewart PL., Johnson CH. DIP original experiment: DIP-66719X PLoS biology 2007 IMEx Elucidating the ticking of an in vitro circadian clockwork. Elucidating the ticking of an in vitro circadian clockwork. Elucidating the ticking of an in vitro circadian clockwork. PLoS biology 2007 imex curation Mori T., Williams DR., Byrne MO., Qin X., Egli M., Mchaourab HS., Stewart PL., Johnson CH. Only protein-protein interactions ecolx Escherichia coli bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Mori T., Williams DR., Byrne MO., Qin X., Egli M., Mchaourab HS., Stewart PL., Johnson CH. DIP original experiment: DIP-66721X PLoS biology 2007 IMEx Elucidating the ticking of an in vitro circadian clockwork. kaic_theeb Circadian clock protein kinase KaiC tlr0483 kaiC protein protein theeb Thermosynechococcus elongatus (strain BP-1) MTNLPEHQSSPTEQSSAEVKKIPTMIEGFDDISHGGLPQGRTTLVSGTSGTGKTLFAVQFLYNGITIFNEPGIFVTFEESPQDIIKNALSFGWNLQSLIDQGKLFILDASPDPDGQEVAGDFDLSALIERIQYAIRKYKATRVSIDSVTAVFQQYDAASVVRREIFRLAFRLKQLGVTTIMTTERVDEYGPVARFGVEEFVSDNVVILRNVLEGERRRRTVEILKLRGTTHMKGEYPFTINNGINIFPLGAMRLTQRSSNVRVSSGVKTLDEMCGGGFFKDSIILATGATGTGKTLLVSKFLETGCQQGERALLFAYEESRAQLSRNASSWGIDFEELERRGLLRIICAYPESAGLEDHLQIIKSEIADFKPSRVAIDSLSALARGVSNNAFRQFVIGVTGFAKQEEITGFFTNTTDQFMGSNSITESHISTITDTILLLQYVEIRGEMSRAINVFKMRGSWHDKGIREYVITEKGAEIRDSFRNFEGIISGTPTRISVDEKTELARIAKGMQDLESE 34E4CDF9DE9C1824 34E4CDF9DE9C1824 kaib_theeb Circadian clock protein KaiB kaiB tlr0482 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQAEDDLGLE BC6B71EFBE6254E3 mint Component of the kaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The kaiABC complex may act as a promoter-non-specific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it decreases the phosphorylation status of kaiC. It has no effect on kaiC by itself, but instead needs the presence of both kaiA and kaiC, suggesting that it acts by antagonizing the interaction between kaiA and kaiC BC6B71EFBE6254E3 kaia_theeb Circadian clock protein KaiA kaiA tlr0481 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAQSTALTICGLVYSPAIGQELVRLHTSDIDELVYFSSEREFCNYLEARRNSIACLILEWGEGTPQIITYLHHSATLLPAILIFPAAPAPPPAGPHYHIAEVILTTDQLDQLNRQIEEAITGFVKLCPGCAVPPHVLFRLPALKESSNVDPQHRLSQKLKERLGYLGVYYKRDTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIHVELMDTFSKQLKLEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPREV D3B0DCBE8A580B4E D3B0DCBE8A580B4E kaic-1 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction kaia-kaic-20 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction kaib-kaic-10 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction kaic-2 4 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction