DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Okamoto K., Sagata N. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Okamoto K., Sagata N. DIP original experiment: DIP-261135X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Okamoto K., Sagata N. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Okamoto K., Sagata N. DIP original experiment: DIP-261139X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Okamoto K., Sagata N. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog pull down pull down western blot western blot Immuno blot Immuno blot Okamoto K., Sagata N. DIP original experiment: DIP-261136X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Okamoto K., Sagata N. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Okamoto K., Sagata N. DIP original experiment: DIP-261137X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Okamoto K., Sagata N. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog pull down pull down predetermined predetermined participant predetermined Okamoto K., Sagata N. DIP original experiment: DIP-261138X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Mechanism for inactivation of the mitotic inhibitory kinase Wee1 at M phase. q9i9k6_xenla Peptidyl-prolyl cis-trans isomerase pin1.L Pin1 pin1 XELAEV_18018988mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MADEEKLPPGWEKRMSRSSGRVYYFNHMTNASQWERPIAGGKNGQGEPGKVRCSHLLVKHNQSRRPSSWRQDKITRSKDEALELINGYIQKMKSGDEDFESLASQFSDCSSAKAGGDLGSFGKGAMQKPFEDASFALRPGEMSGPVFTDSGIHIILRTE DIP protein Q9I9K6 original sequence version: 71 4E54F66F16C9DF1C cdk2_xenla Cyclin-dependent kinase 2 cdk2 eg1 CDC2 homolog Eg1 protein kinase Cell division protein kinase 2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MENFQKVEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLNQDLKKFMDGSNISGISLALVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINSDGAIKLADFGLARAFGVPVRTFTHEVVTLWYRAPEILLGCKFYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTFPKWIRQDFSKVVPPLDEDGRDLLAQMLQYDSNKRISAKVALTHPFFRDVSRPTPHLI DIP protein P23437 original sequence version: 94 ccnb2_xenla G2/mitotic-specific cyclin-B2 ccnb2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MATRRAAIPREADNILGGAMRSKVQMNSRRAALGEIGNKVTVRGKPPAVKQSSNAVAKPSKMAATKVANVKTKHVPVKPVVAEAAPKVPSPVPMDVSLKEEELCQAFSDALTSVEDIDADDGGNPQLCSDYVMDIYNYLKQLEVQQSVHPCYLEGKEINERMRAILVDWLVQVHSRFQLLQETLYMGVAIMDRFLQVQPVSRSKLQLVGVTSLLIASKYEEMYTPEVADFVYITDNAYTASQIREMEMIILRLLNFDLGRPLPLHFLRRASKSCSADAEQHTLAKYLMELTLIDYEMVHIKPSEIAAAALCLSQKILGQGTWGTTQHYYTGYTEGDLQLIMKHMAKNITKVNQNLTKHVAVRNKYASSKLMKISTLPQLMAPLITELAASLS DIP protein P13351 original sequence version: 93 87295E04C106218E wee1b_xenla Wee1-like protein kinase 1-B wee1-b Zygotic wee1-like protein kinase 1B protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNVQPRNMNVQPRNMNVQPVRHKLFFSDTDEEEEDGHSTGEDSAFQESDSPVSRQREKQEGKPPGGTWEELEEEEGFGSSPIKSPGDFFMSDSPSYRQLAPASPTRSPQGPTSPIPECPGTPPHKTFRKLRLFDTPHTPKSLLSKARGIGSSALRFRGGTLFREAEKAPKPEFVYSTPQVNINPFTPDSLEIQSSAGLCRGRKRALLNDSCGEDMEGSDCELEDEDIRPAKRIPITESNMKSRYATEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHPHVVRYYSAWAEDDHMLIQNEYCNGGSLSDVISENYRTMQYFTEPELKDLLLQVARGLKYIHSMSLVHMDIKPSNIFISRTTLPNTAVEEADDEECGSGKVIYKIGDLGHVTRVSSPQVEEGDSRFLANEVLQENYTHLAKADIFALALTVWSAAGAEPFPTNGDQWHEIRQGKLPRVPQLLSQEFVDLIKLMISPDPEKRPSSVALVKHSVLLSASRKSAEQLRIELDAEKFKNALLQKELKKAQIAKAAAEERAHFPDRIATRSTTQNNRTTRLIGKKMNRSVSLTIY DIP protein Q8QGV2 original sequence version: 79 wee1_b-pin1-1 2 6 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog 9 unspecified role unspecified role bait bait Region 179-191 Region 179-191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain pT186 pT186 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro physical association physical association wee1_b-1 1 9 putative self putative self unspecified role unspecified role Q8QGV2:p.Lys277Arg K277R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K277R'. Wed May 02 14:40:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys277arg' Tue Jun 30 19:08:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys277Arg' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation true wee1_b-ccnb2-1 3 8 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog 7 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range xenla Xenopus laevis (African clawed frog) African clawed frog association association pin1-wee1_b-1 5 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range xenla Xenopus laevis (African clawed frog) African clawed frog 9 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8QGV2:p.Thr186Ala T186A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T186A'. Wed May 02 14:33:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr186ala' Tue Jun 30 17:54:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr186Ala' xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association wee1_b-wee1_b-1 4 9 unspecified role unspecified role bait bait Region 242-595 Region 242-595 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 unspecified role unspecified role prey prey Region 1-241 Region 1-241 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm putative self interaction putative self interaction