DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Structure (London, England : 1993) 2007 imex curation Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. DIP original experiment: DIP-66653X Structure (London, England : 1993) 2007 IMEx Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Structure (London, England : 1993) 2007 imex curation Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. DIP original experiment: DIP-255909X Structure (London, England : 1993) 2007 IMEx Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Structure (London, England : 1993) 2007 imex curation Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. DIP original experiment: DIP-66654X Structure (London, England : 1993) 2007 IMEx Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Structure (London, England : 1993) 2007 imex curation Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. DIP original experiment: DIP-66652X Structure (London, England : 1993) 2007 IMEx Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Structure (London, England : 1993) 2007 imex curation Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. DIP original experiment: DIP-255910X Structure (London, England : 1993) 2007 IMEx Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Multiprotein expression strategy for structural biology of eukaryotic complexes. Structure (London, England : 1993) 2007 imex curation Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Fitzgerald DJ., Schaffitzel C., Berger P., Wellinger R., Bieniossek C., Richmond TJ., Berger I. DIP original experiment: DIP-255911X Structure (London, England : 1993) 2007 IMEx Multiprotein expression strategy for structural biology of eukaryotic complexes. taf6_human Transcription initiation factor TFIID subunit 6 Transcription initiation factor TFIID 70 kDa subunit Transcription initiation factor TFIID 80 kDa subunit RNA polymerase II TBP-associated factor subunit E TAF6 TAF2E TAFII70 protein protein human Homo sapiens Human MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP DIP protein P49848 original sequence version: 66 06C6BFA563580823 taf9_human Transcription initiation factor TFIID subunit 9 Transcription initiation factor TFIID 31 kDa subunit Transcription initiation factor TFIID 32 kDa subunit RNA polymerase II TBP-associated factor subunit G STAF31/32 TAF9 TAF2G TAFII31 protein protein human Homo sapiens Human MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL DIP protein Q16594 original sequence version: 66 DIP protein Q16594 original sequence version: 105 DIP protein Q16594 original sequence version: 131 1925AEC65D6C84C7 taf5_human Transcription initiation factor TFIID subunit 5 Transcription initiation factor TFIID 100 kDa subunit TAF5 TAF2D protein protein human Homo sapiens Human MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ DIP protein Q15542 original sequence version: 141 DIP protein Q15542 original sequence version: 62 DIP protein Q15542 original sequence version: 131 DIP protein Q15542 original sequence version: 152 87A178BFB7071992 taf5-taf6-5 4 8 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction taf5-taf6-6 1 8 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction taf5-taf6-7 3 8 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction taf5-taf6-8 2 8 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction 1 nodeMerge04 2013-12-24 taf5-taf6-9 5 8 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction 1 nodeMerge04 2013-12-24 taf5-taf6-10 6 8 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction 1 nodeMerge04 2013-12-24