DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. DIP original experiment: DIP-261008X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. DIP original experiment: DIP-261007X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. DIP original experiment: DIP-261005X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. DIP original experiment: DIP-261003X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. DIP original experiment: DIP-261006X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. DIP original experiment: DIP-261004X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Influenza virus targets the mRNA export machinery and the nuclear pore complex. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Satterly N., Tsai PL., van Deursen J., Nussenzveig DR., Wang Y., Faria PA., Levay A., Levy DE., Fontoura BM. DIP original experiment: DIP-261009X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Influenza virus targets the mRNA export machinery and the nuclear pore complex. ns1_i33a0 Non-structural protein 1 NS NS1A protein protein i33a0 Influenza A virus (strain A/Wilson-Smith/1933 H1N1) Influenza A virus (strain A/WS/1933 H1N1) MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMTMASVPASRYLTDMTLEEMSRHWFMLMPKQKVAGPLCIRMDQAIMDKNIILKANFSVILDRLETLILLRAFTEEGTIVGEISPLPSLPGHTDEDVKNAVGVLIGGLEWNNNTVRVSETLQRFAWRSSNENGRPPLTPKQKRKMAGTIRSEV DIP protein Q82506 original sequence version: 71 DIP protein Q82506 original sequence version: 67 E33D5512E090CF08 rae1l_human mRNA export factor mRNA-associated protein mrnp 41 Rae1 protein homolog RAE1 MRNP41 protein protein human Homo sapiens Human MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK DIP protein P78406 original sequence version: 142 DIP protein P78406 original sequence version: 132 DIP protein P78406 original sequence version: 97 DIP protein P78406 original sequence version: 103 89A99C34BA668A97 nxt1_human NTF2-related export protein 1 NXT1 Protein p15 protein protein human Homo sapiens Human MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS DIP protein Q9UKK6 original sequence version: 111 358FA86AC3944594 nup98_human Nuclear pore complex protein Nup98-Nup96 NUP98 ADAR2 protein protein human Homo sapiens Human MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPGGLFGTSSFSQPATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNFGTSTSSGGLFGTTNTTSNPFGSTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGFSFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAVGSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIFGSKPAPGTLGTGLGAGFGTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTTTATLGFGAPQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKLSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL DIP protein P52948 original sequence version: 164 DIP protein P52948 original sequence version: 153 DIP protein P52948 original sequence version: 118 DIP protein P52948 original sequence version: 125 BC60E5456B936C79 nxf1_human Nuclear RNA export factor 1 NXF1 TAP Tip-associating protein Tip-associated protein mRNA export factor TAP protein protein human Homo sapiens Human MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK DIP protein Q9UBU9 original sequence version: 157 DIP protein Q9UBU9 original sequence version: 146 338872AADA789FBF hnrl1_human Heterogeneous nuclear ribonucleoprotein U-like protein 1 E1BAP5 HNRNPUL1 HNRPUL1 Adenovirus early region 1B-associated protein 5 E1B-55 kDa-associated protein 5 protein protein human Homo sapiens Human MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYENRGPPGGNRGGFQNRGGGSGGGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ DIP protein Q9BUJ2 original sequence version: 124 6E57C0271E5F3A77 ns-hnrnpul1-1 5 13 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait Region 1-73 Region 1-73 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ns-nxf1-1 4 9 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait Region 1-73 Region 1-73 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association ns-hnrnpul1-2 3 13 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association ns-nxt1-1 1 10 unspecified role unspecified role prey prey ZZ-tag ZZ-tag zz tag zz tag ZZ tag ZZ tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 74-230 Region 74-230 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ns-nxt1-2 2 10 unspecified role unspecified role prey prey ZZ-tag ZZ-tag zz tag zz tag ZZ tag ZZ tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association ns-nxt1-3 6 10 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait Region 74-230 Region 74-230 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ns-hnrnpul1-3 7 13 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role prey prey ZZ-tag ZZ-tag zz tag zz tag ZZ tag ZZ tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association