DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Effect of phosphorylation and S-S bond-induced dimerization on DNA binding and transcriptional activation by C/EBPbeta. Effect of phosphorylation and S-S bond-induced dimerization on DNA binding and transcriptional activation by C/EBPbeta. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Kim JW., Tang QQ., Li X., Lane MD. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Kim JW., Tang QQ., Li X., Lane MD. DIP original experiment: DIP-261001X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Effect of phosphorylation and S-S bond-induced dimerization on DNA binding and transcriptional activation by C/EBPbeta. Effect of phosphorylation and S-S bond-induced dimerization on DNA binding and transcriptional activation by C/EBPbeta. Effect of phosphorylation and S-S bond-induced dimerization on DNA binding and transcriptional activation by C/EBPbeta. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Kim JW., Tang QQ., Li X., Lane MD. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Kim JW., Tang QQ., Li X., Lane MD. DIP original experiment: DIP-261002X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Effect of phosphorylation and S-S bond-induced dimerization on DNA binding and transcriptional activation by C/EBPbeta. mk01_mouse Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein mouse Mus musculus Mouse MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P63085 original sequence version: 120 DIP protein P63085 original sequence version: 94 DIP protein P63085 original sequence version: 88 DIP protein P63085 original sequence version: 103 DIP protein P63085 original sequence version: 121 DIP protein P63085 original sequence version: 101 3BBCF22471EDBA0B cebpb_mouse CCAAT/enhancer-binding protein beta Cebpb Interleukin-6-dependent-binding protein Liver-enriched transcriptional activator AGP/EBP protein protein mouse Mus musculus Mouse MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC DIP protein P28033 original sequence version: 133 DIP protein P28033 original sequence version: 135 DIP protein P28033 original sequence version: 131 827AC4AFC209AE89 cebpb-mapk1-1 1 3 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 4 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation cebpb-1 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction