DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase. Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Forouhar F., Anderson JL., Mowat CG., Vorobiev SM., Hussain A., Abashidze M., Bruckmann C., Thackray SJ., Seetharaman J., Tucker T., Xiao R., Ma LC., Zhao L., Acton TB., Montelione GT., Chapman SK., Tong L. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Forouhar F., Anderson JL., Mowat CG., Vorobiev SM., Hussain A., Abashidze M., Bruckmann C., Thackray SJ., Seetharaman J., Tucker T., Xiao R., Ma LC., Zhao L., Acton TB., Montelione GT., Chapman SK., Tong L. DIP original experiment: DIP-260550X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase. Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase. Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Forouhar F., Anderson JL., Mowat CG., Vorobiev SM., Hussain A., Abashidze M., Bruckmann C., Thackray SJ., Seetharaman J., Tucker T., Xiao R., Ma LC., Zhao L., Acton TB., Montelione GT., Chapman SK., Tong L. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Forouhar F., Anderson JL., Mowat CG., Vorobiev SM., Hussain A., Abashidze M., Bruckmann C., Thackray SJ., Seetharaman J., Tucker T., Xiao R., Ma LC., Zhao L., Acton TB., Montelione GT., Chapman SK., Tong L. DIP original experiment: DIP-260551X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase. q8e972_sheon kynA SO_4414 protein protein sheon Shewanella oneidensis (strain MR-1) MKPATYNTEAFDEWIRSRFVELNSQLEQLYYQQTDRANVQEVGTELKHTLESEGRELVKALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPTRETTSPLLEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPDEKLFVDYNTKGILAYKRASDALLKIQPLGISHPISHDLLRVTKQALQDVIESNQQLFNRLDTDRFFYCVRPYYKPYRVGSVVYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQILRECMRRPNLMDDFLQAKGCIHQDWYQENLKLFIEVCELHGQTAIQHHNELVTKYIAEPSVSMEQQHLAKVTASGPPLHVLLASLERLRDRRAAVLRDDIRTRYYDLKKLKDSLR DIP protein Q8E972 original sequence version: 61 t23o_xancp Tryptophan 2,3-dioxygenase kynA Tryptamin 2,3-dioxygenase Tryptophan oxygenase Tryptophan pyrrolase Tryptophanase XCC0432 protein protein strain atcc 33913 / Xanthomonas campestris pv. campestris MPVDKNLRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDNRPPQGSADAGKR DIP protein Q8PDA8 original sequence version: 67 kyna-1 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction kyna-2 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction