DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Rummel A., Eichner T., Weil T., Karnath T., Gutcaits A., Mahrhold S., Sandhoff K., Proia RL., Acharya KR., Bigalke H., Binz T. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rummel A., Eichner T., Weil T., Karnath T., Gutcaits A., Mahrhold S., Sandhoff K., Proia RL., Acharya KR., Bigalke H., Binz T. DIP original experiment: DIP-260531X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Rummel A., Eichner T., Weil T., Karnath T., Gutcaits A., Mahrhold S., Sandhoff K., Proia RL., Acharya KR., Bigalke H., Binz T. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rummel A., Eichner T., Weil T., Karnath T., Gutcaits A., Mahrhold S., Sandhoff K., Proia RL., Acharya KR., Bigalke H., Binz T. DIP original experiment: DIP-260529X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Rummel A., Eichner T., Weil T., Karnath T., Gutcaits A., Mahrhold S., Sandhoff K., Proia RL., Acharya KR., Bigalke H., Binz T. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rummel A., Eichner T., Weil T., Karnath T., Gutcaits A., Mahrhold S., Sandhoff K., Proia RL., Acharya KR., Bigalke H., Binz T. DIP original experiment: DIP-260532X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Rummel A., Eichner T., Weil T., Karnath T., Gutcaits A., Mahrhold S., Sandhoff K., Proia RL., Acharya KR., Bigalke H., Binz T. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rummel A., Eichner T., Weil T., Karnath T., Gutcaits A., Mahrhold S., Sandhoff K., Proia RL., Acharya KR., Bigalke H., Binz T. DIP original experiment: DIP-260530X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Identification of the protein receptor binding site of botulinum neurotoxins B and G proves the double-receptor concept. bxg_clobo Botulinum neurotoxin type G botG Bontoxilysin-G protein protein clobo Clostridium botulinum MPVNIKXFNYNDPINNDDIIMMEPFNDPGPGTYYKAFRIIDRIWIVPERFTYGFQPDQFNASTGVFSKDVYEYYDPTYLKTDAEKDKFLKTMIKLFNRINSKPSGQRLLDMIVDAIPYLGNASTPPDKFAANVANVSINKKIIQPGAEDQIKGLMTNLIIFGPGPVLSDNFTDSMIMNGHSPISEGFGARMMIRFCPSCLNVFNNVQENKDTSIFSRRAYFADPALTLMHELIHVLHGLYGIKISNLPITPNTKEFFMQHSDPVQAEELYTFGGHDPSVISPSTDMNIYNKALQNFQDIANRLNIVSSAQGSGIDISLYKQIYKNKYDFVEDPNGKYSVDKDKFDKLYKALMFGFTETNLAGEYGIKTRYSYFSEYLPPIKTEKLLDNTIYTQNEGFNIASKNLKTEFNGQNKAVNKEAYEEISLEHLVIYRIAMCKPVMYKNTGKSEQCIIVNNEDLFFIANKDSFSKDLAKAETIAYNTQNNTIENNFSIDQLILDNDLSSGIDLPNENTEPFTNFDDIDIPVYIKQSALKKIFVDGDSLFEYLHAQTFPSNIENLQLTNSLNDALRNNNKVYTFFSTNLVEKANTVVGASLFVNWVKGVIDDFTSESTQKSTIDKVSDVSIIIPYIGPALNVGNETAKENFKNAFEIGGAAILMEFIPELIVPIVGFFTLESYVGNKGHIIMTISNALKKRDQKWTDMYGLIVSQWLSTVNTQFYTIKERMYNALNNQSQAIEKIIEDQYNRYSEEDKMNINIDFNDIDFKLNQSINLAINNIDDFINQCSISYLMNRMIPLAVKKLKDFDDNLKRDLLEYIDTNELYLLDEVNILKSKVNRHLKDSIPFDLSLYTKDTILIQVFNNYISNISSNAILSLSYRGGRLIDSSGYGATMNVGSDVIFNDIGNGQFKLNNSENSNITAHQSKFVVYDSMFDNFSINFWVRTPKYNNNDIQTYLQNEYTIISCIKNDSGWKVSIKGNRIIWTLIDVNAKSKSIFFEYSIKDNISDYINKWFSITITNDRLGNANIYINGSLKKSEKILNLDRINSSNDIDFKLINCTDTTKFVWIKDFNIFGRELNATEVSSLYWIQSSTNTLKDFWGNPLRYDTQYYLFNQGMQNIYIKYFSKASMGETAPRTNFNNAAINYQNLYLGLRFIIKKASNSRNINNDNIVREGDYIYLNIDNISDESYRVYVLVNSKEIQTQLFLAPINDDPTFYDVLQIKKYYEKTTYNCQILCEKDTKTFGLFGIGKFVKDYGYVWDTYDNYFCISQWYLRRISENINKLRLGCNWQFIPVDEGWTE DIP protein Q60393 original sequence version: 99 mint 306CF54CF3973C3B syt2_mouse Synaptotagmin-2 Syt2 Inositol polyphosphate-binding protein Synaptotagmin II protein protein mouse Mus musculus Mouse MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK DIP protein P46097 original sequence version: 113 DIP protein P46097 original sequence version: 117 B4BD13FF70E0481B bxb_clobo Botulinum neurotoxin type B botB Bontoxilysin-B protein protein clobo Clostridium botulinum MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFNKSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLGDRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNHFASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLYGIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIVDRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETNIAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQAYEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSNYIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQYLYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVNDFVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLIPVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMYKALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDLSIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFKLTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLYIGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCISKWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE DIP protein P10844 original sequence version: 126 DIP protein P10844 original sequence version: 130 mint Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that cleaves the '76-Gln-|-Phe-77' bond of synaptobrevin-2 921DE5C518140DBD syt1_mouse Synaptotagmin-1 Synaptotagmin I p65 Syt1 protein protein mouse Mus musculus Mouse MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P46096 original sequence version: 132 7FDEFF37170BD169 syt1-botg-1 2 5 unspecified role unspecified role prey prey Region 877-1297 Region 877-1297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q60393:p.Met1126Asp M1126D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M D This feature has been corrected as a result of our quality control procedures. The original label was 'M1126D'. Wed May 02 16:04:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1126asp' Tue Jun 30 17:19:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1126Asp' Q60393:p.Leu1191Arg L1191R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L R This feature has been corrected as a result of our quality control procedures. The original label was 'L1191R'. Wed May 02 16:54:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1191arg' Tue Jun 30 16:27:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1191Arg' Q60393:p.Gln1200Glu Q1200E/K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q E Wed May 02 20:33:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln1200glu' Tue Jun 30 15:39:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln1200Glu' Q60393:p.Gln1200Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q K Wed May 02 20:24:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln1200lys' Tue Jun 30 17:57:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln1200Lys' ecolx Escherichia coli 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-53 Region 1-53 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction syt1-botb-2 3 7 unspecified role unspecified role prey prey P10844:p.Trp1262Leu W1262L mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W L This feature has been corrected as a result of our quality control procedures. The original label was 'W1262L'. Wed May 02 16:32:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp1262leu' Tue Jun 30 20:00:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp1262Leu' P10844:p.Lys1192Met K1192M/E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K M Wed May 02 16:59:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1192met' Tue Jun 30 15:40:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1192Met' P10844:p.Tyr1183Arg Y1183R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y R This feature has been corrected as a result of our quality control procedures. The original label was 'Y1183R'. Wed May 02 16:20:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr1183arg' Tue Jun 30 17:40:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr1183Arg' P10844:p.Val1118Asp V1118D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V D This feature has been corrected as a result of our quality control procedures. The original label was 'V1118D'. Wed May 02 15:31:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1118asp' Tue Jun 30 19:57:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1118Asp' Region 853-1291 Region 853-1291 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P10844:p.Lys1192Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:08:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1192glu' Tue Jun 30 16:42:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1192Glu' ecolx Escherichia coli 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-82 Region 1-82 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction syt2-botg-1 1 5 unspecified role unspecified role prey prey Region 877-1297 Region 877-1297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q60393:p.Met1126Asp M1126D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M D This feature has been corrected as a result of our quality control procedures. The original label was 'M1126D'. Wed May 02 15:53:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1126asp' Tue Jun 30 17:55:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1126Asp' Q60393:p.Leu1191Arg L1191R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L R This feature has been corrected as a result of our quality control procedures. The original label was 'L1191R'. Wed May 02 15:11:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1191arg' Tue Jun 30 18:42:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1191Arg' Q60393:p.Gln1200Glu Q1200E/K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q E Wed May 02 16:02:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln1200glu' Tue Jun 30 18:47:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln1200Glu' Q60393:p.Gln1200Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q K Wed May 02 14:42:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln1200lys' Tue Jun 30 16:26:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln1200Lys' ecolx Escherichia coli 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-61 Region 1-61 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction syt2-botb-6 4 7 unspecified role unspecified role prey prey Region 853-1291 Region 853-1291 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P10844:p.Lys1192Glu K1192E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K1192E'. Wed May 02 17:34:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1192glu' Tue Jun 30 18:46:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1192Glu' P10844:p.Val1118Asp V1118D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V D This feature has been corrected as a result of our quality control procedures. The original label was 'V1118D'. Wed May 02 15:04:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1118asp' Tue Jun 30 16:17:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1118Asp' P10844:p.Tyr1183Arg Y1183R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y R This feature has been corrected as a result of our quality control procedures. The original label was 'Y1183R'. Wed May 02 19:41:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr1183arg' Tue Jun 30 19:58:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr1183Arg' ecolx Escherichia coli 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-61 Region 1-61 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction