DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. Nature 2007 imex curation Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. DIP original experiment: DIP-253230X Nature 2007 IMEx CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. Nature 2007 imex curation Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. DIP original experiment: DIP-253227X Nature 2007 IMEx CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. Nature 2007 imex curation Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. DIP original experiment: DIP-253228X Nature 2007 IMEx CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. Nature 2007 imex curation Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. DIP original experiment: DIP-253225X Nature 2007 IMEx CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. Nature 2007 imex curation Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. DIP original experiment: DIP-253226X Nature 2007 IMEx CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. Nature 2007 imex curation Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tanaka S., Umemori T., Hirai K., Muramatsu S., Kamimura Y., Araki H. DIP original experiment: DIP-253229X Nature 2007 IMEx CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast. sld5_yeast DNA replication complex GINS protein SLD5 YDR489W SLD5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDINIDDILAELDKETTAVDSTKITQGSSSTTHRDANTIVGSSLDLNDKTQIYVSPQQDFSDLMKSWKNERCSPELLPYPHQLMKRLLNRISMQSQLIENISMGFLDMQNASNANPPMPNESKLPLLCMETELERLKFVIRSYIRCRLSKIDKFSLYLRQLNEDENSLISLTDLLSKDEIKYHDTHSLIWLKLVNDSILKYMPEELQAINDTEGSVNMIDEPDWNKFVFIHVNGPPDGKWNEDPLLQENEFGKPCYTVTIPDLKEEVELTIGSIYVMRYEVIRDLLRDDKVALI 7EC516ADAD9900DD 7EC516ADAD9900DD mcm2_yeast DNA replication licensing factor MCM2 MCM2 YBL023C YBL0438 Minichromosome maintenance protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPDIDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERDRLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREELTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVDAQKVSVRRQLRRSFAIYTLGH F38FF682581B0EC0 F38FF682581B0EC0 dpb11_yeast DNA replication regulator DPB11 DPB11 J0918 YJL090C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKPFQGITFCPTAINNEILAKKISKKIIKLGGIFSKDLTRQVNVLVVGSTTNTNKFKFAVKHRFDIIFIDIQAIDDIYQLWLSGENILPDSNTATMTGSTYEMLKILYRRFSFKYLHNFNIFIGRITDTNITSIDSLVRSIKKLGCSSYNYQNFVIKDTSSHNDDDDQGQNGQISIFVTDTLLGARVNAAIEQNIPIVHFKWILDCQKRSALLPYDPYYLLPNIKDLPYDSIGSNSCDCWDKINTTFPTNIDAQSSLQRQQSSSTLTPSLPKTSSLLNKFKPKGEKIWDKAMSLQQHSKTNFSVLGQSPLSINNKQEDLSDNSTLIFKNCAFIIHHIFPGNHRSILTKIVVQNGGKIETSYLSGIYDHSYYIIPSNKALDSFNDLPEIIDDNDGIVTEFFIERCLYYQKLLHPIDLWSKPFLSTIEFQVSSSSKLLHHEFSSSPFLNVTITGFSGVELLHLTKVLNLLKPMGINYVEYLNKSTDILLINLAALPSIPKTHPLWSNEFSDLFTQFCINNNNDDPGDNNRKDFQNNSILRNSMKRKIEYIKKFHSIPVVTPAFIFKLLSAASGENNEIFLNNIKWCIICPRGHKDDFKCKIKKPYYTSISSEKKYQNNDPKIDKTILLKRNNSSLSEHSMKDTKNELLQKIRETDSGRKKRSVSSSIMDVSSERQMPDTKRIKLESLPKNFVPKQIKRTTSWGTIMSENVPTEQPTAISNPEEIPRTEEVSHTQVTYGSIQDKKRTASLEKPMRRQTRNQTKELDS 79B3A9BC7815E440 79B3A9BC7815E440 cdc45_yeast Cell division control protein 45 CDC45 YLR103C L8004.11 SLD4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYYGISQFSEAYNKILRNSSSHSSCQLVIFVSCLNIDALCATKMLSLLFKKQLVQSQIVPIFGYSELRRHYSQLDDNINSLLLVGFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDIYVLDAHRPWNLDNIFGSQIIQCFDDGTVDDTLGEQKEAYYKLLELDEESGDDELSGDENDNNGGDDEATDADEVTDEDEEDEDETISNKRGNSSIGPNDLSKRKQRKKQIHEYEGVLEEYYSQGTTVVNSISAQIYSLLSAIGETNLSNLWLNILGTTSLDIAYAQVYNRLYPLLQDEVKRLTPSSRNSVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLHKMFARMGIPLSTAQETWLYMDHSIKRELGIIFDKNLDRYGLQDIIRDGFVRTLGYRGSISASEFVEALTALLEVGNSTDKDSVKINNDNNDDTDGEEEEDNSAQKLTNLRKRWVSNFWLSWDALDDRKVELLNRGIQLAQDLQRAIFNTGVAILEKKLIKHLRIYRLCVLQDGPDLDLYRNPLTLLRLGNWLIECCAESEDKQLLPMVLASIDENTDTYLVAGLTPRYPRGLDTIHTKKPILNNFSMAFQQITAETDAKVRIDNFESSIIEIRREDLSPFLEKLTLSGLL 6500DDD62EC4E8EE 6500DDD62EC4E8EE psf3_yeast DNA replication complex GINS protein PSF3 YOL146W Partner of Sld five 3 PSF3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGYYDIDDVLADGTEFPCKFQYDIPGLGYLENNPGRPITKNTKLSLPLWLARILAIVGGDEALVDEEPVPFVELLPPDMFSTKVMNAIKTDPVALDLHSINSHFFSLAIKWIMLFSEKELANVVSELLLQRAQELNHHASSLSIDLNADSTGKNSANTNIATSTFLLKLEEMEKEIYKKSHESYKDTKRWMFKK 3E8B60DFCE16391D 3E8B60DFCE16391D sld3_yeast DNA replication regulator SLD3 SLD3 G2980 YGL113W protein protein yeast Saccharomyces cerevisiae Baker's yeast METWEVIASVKEATKGLDLSLDHPLIIKSEDVPSNILQLLQQKNRRQLKHICMKSRKEYFLLEEYGPGFWVKWPYNYFNGYSLPERRTEVVTTVERERAKRETLKTWDELKFKELLHLWSEEPKGSCKLEKDKDLKLDMNPPDMKGESKINDYYSDPKEYIESKYYDALFSIHTPLAYFVKSNLVRLKNTCRTKYGSDSYKIAYQAMLQKFLLSIVQFKDRHDNRLLLEPFSSPIADEKRKNCLTKFVIQDENKNSSTIADLCVVLKSREIKLQILLLLEIIGLNDLDWNFRDFEKKYKLKLKKRSLNLTKKGLVRRRSKKKTSEKDKGIERITTSLDYCEQLDLYLDRACILDILLSSETPNPDAIEASNGTIQEHKKNILDKSKEASLVGFINYVLIPYFNKKVPHAVEFIIQKLKGPSMRPKRALKKVNDSTNVSSPNTVETYNRLSTSQRASRSSIINSVPSSPALRRVDANLFSRKSIASPTPELLNSRTNSNLNEFLESETRSLKRPSQLGRTKSDLTMNHLQKRQFSVSDLSTTRVPNSSTITLKTPFSHSTINAYKTMNNSFRRVGKRKDINETIRLHERVDSEENVQVQATPAVKKRTVTPNKKAQLQSIIESPLNFKDDDTHEGRKNTSNITSTPTNKPPENSSKRRVRRRLFAPEST 6E59D0DB3C082C28 6E59D0DB3C082C28 cdc45-sld3-5 4 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey Region 1-548 Region 1-548 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc45-sld3-6 6 10 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction dpb11-sld3-1 5 9 unspecified role unspecified role bait bait Region 1-309 Region 1-309 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc45-mcm2-1 3 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait Q08032:p.His22Tyr Y22H mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H Y Wed May 02 14:58:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his22tyr' Tue Jun 30 19:17:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His22Tyr' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association dpb11-sld3-2 1 9 unspecified role unspecified role bait bait Region 1-309 Region 1-309 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey Region 527-668 Region 527-668 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P53135:p.[Thr600Ala;Ser622Ala] T600A/S622A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T600A/S622A'. Wed May 02 17:31:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr600ala,ser622ala' Tue Jun 30 18:56:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr600Ala;Ser622Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sld3-dpb11-1 2 9 unspecified role unspecified role prey prey CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 12 unspecified role unspecified role bait bait Region 527-668 Region 527-668 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association