DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. DIP original experiment: DIP-264250X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. DIP original experiment: DIP-264254X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. DIP original experiment: DIP-264253X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. DIP original experiment: DIP-264252X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. DIP original experiment: DIP-264251X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zamborlini A., Usami Y., Radoshitzky SR., Popova E., Palu G., Göttlinger H. DIP original experiment: DIP-264249X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding. stabp_human STAM-binding protein AMSH STAMBP Associated molecule with the SH3 domain of STAM Endosome-associated ubiquitin isopeptidase protein protein human Homo sapiens Human MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR DIP protein O95630 original sequence version: 125 DIP protein O95630 original sequence version: 88 DIP protein O95630 original sequence version: 103 7B6E08A245BD9D43 q9y3e7-1 Charged multivesicular body protein 3 CHMP3 CGI149 NEDF VPS24 Chromatin-modifying protein 3 Neuroendocrine differentiation factor Vacuolar protein sorting-associated protein 24 CGI-149 Vps24alpha protein protein human Homo sapiens Human MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS DIP protein Q9Y3E7-1 original sequence version: 120 DIP protein Q9Y3E7 original sequence version: 72 DIP protein Q9Y3E7-1 original sequence version: 83 vps4a_human Vacuolar protein sorting-associated protein 4A VPS4-1 Protein SKD2 VPS4A VPS4 protein protein human Homo sapiens Human MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES DIP protein Q9UN37 original sequence version: 134 DIP protein Q9UN37 original sequence version: 116 DIP protein Q9UN37 original sequence version: 127 C3CC556FB84F105C chm4b_mouse Charged multivesicular body protein 4b Chmp4b Chromatin-modifying protein 4b protein protein mouse Mus musculus Mouse MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSVALPSKPAKKKEEEDDDMKELENWAGSM DIP protein Q9D8B3 original sequence version: 110 mint Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-III complex is probably involved in the concentration of MVB cargo. In the ESCRT-III complex, it probably serves as an acceptor for ESCRT-I complex on endosomal membranes DB1D79C3C9ECCB2F chmp3-chmp3-3 6 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-150 Region 1-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 8 unspecified role unspecified role bait bait Region 151-179 Region 151-179 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association chmp3-chmp3-4 2 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-113 Region 1-113 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 151-222 Region 151-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association chmp4b-chmp4b-7 5 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-153 Region 1-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 154-224 Region 154-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association chmp3-vps4a-1 3 9 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait Region 151-222 Region 151-222 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association chmp3-chmp3-5 1 8 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 151-222 Region 151-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association chmp3-stambp-12 4 7 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait Region 151-222 Region 151-222 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9Y3E7-1:p.[Arg216Ala;Leu217Ala] R216A/L217A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R216A/L217A'. Wed May 02 16:18:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg216ala,leu217ala' Tue Jun 30 16:03:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg216Ala;Leu217Ala]' ecolx Escherichia coli physical association physical association