DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. DIP original experiment: DIP-264239X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. DIP original experiment: DIP-264237X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. DIP original experiment: DIP-264238X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. DIP original experiment: DIP-264241X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. DIP original experiment: DIP-264235X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. Only protein-protein interactions mouse Mus musculus Mouse pull down pull down western blot western blot Immuno blot Immuno blot Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. DIP original experiment: DIP-264240X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Stumpf M., Waskow C., Krötschel M., van Essen D., Rodriguez P., Zhang X., Guyot B., Roeder RG., Borggrefe T. DIP original experiment: DIP-264236X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The mediator complex functions as a coactivator for GATA-1 in erythropoiesis via subunit Med1/TRAP220. med1_human Mediator of RNA polymerase II transcription subunit 1 TRIP2 MED1 ARC205 DRIP205 TRAP220 Activator-recruited cofactor 205 kDa component Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Thyroid hormone receptor-associated protein complex 220 kDa component Thyroid receptor-interacting protein 2 p53 regulatory protein RB18A Vitamin D receptor-interacting protein complex component DRIP205 CRSP1 CRSP200 DRIP230 PBP PPARBP PPARGBP RB18A protein protein human Homo sapiens Human MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQNPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPADLIADAAGSPSSDSPTNHFFHDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSAGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSGSSQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTPPSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN DIP protein Q15648 original sequence version: 135 DIP protein Q15648 original sequence version: 149 DIP protein Q15648 original sequence version: 100 DIP protein Q15648-1 original sequence version: 113 FCE0FE87EF08B887 ccnc_human Cyclin-C CCNC SRB11 homolog protein protein human Homo sapiens Human MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS DIP protein P24863 original sequence version: 150 DIP protein P24863 original sequence version: 141 DIP protein P24863 original sequence version: 97 DIP protein P24863-1 original sequence version: 159 DIP protein P24863 original sequence version: 147 CF8AC5E94E621F4C med16_human Mediator of RNA polymerase II transcription subunit 16 MED16 Mediator complex subunit 16 Thyroid hormone receptor-associated protein complex 95 kDa component Thyroid hormone receptor-associated protein 5 DRIP92 THRAP5 Vitamin D3 receptor-interacting protein complex 92 kDa component protein protein human Homo sapiens Human MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWESSVGSLVEGDPIVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAFTGGGNIVVATADGSSASPVQFYKVCVSVVSEKCRIDTEILPSLFMRCTTDLNRKDKFPAITHLKFLARDMSEQVLLCASSQTSSIVECWSLRKEGLPVNNIFQQISPVVGDKQPTILKWRILSATNDLDRVSAVALPKLPISLTNTDLKVASDTQFYPGLGLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMKRPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLAVEGRGPDACVTSRASEEAPAFVQLGPQSTHHSPRTPRSLDHLHPEDRP DIP protein Q9Y2X0 original sequence version: 115 DIP protein Q9Y2X0 original sequence version: 66 15173F237A75D230 gata1_human Erythroid transcription factor GATA1 ERYF1 GF1 Eryf1 GATA-binding factor 1 NF-E1 DNA-binding protein protein protein human Homo sapiens Human MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS DIP protein P15976 original sequence version: 163 DIP protein P15976 original sequence version: 113 DIP protein P15976 original sequence version: 146 822BD2DE14B908AD med19_human Mediator of RNA polymerase II transcription subunit 19 MED19 LCMR1 Lung cancer metastasis-related protein 1 Mediator complex subunit 19 protein protein human Homo sapiens Human MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR DIP protein A0JLT2 original sequence version: 76 9B85721364F33F02 med21_human Mediator of RNA polymerase II transcription subunit 21 SRB7 MED21 Mediator complex subunit 21 RNA polymerase II holoenzyme component SRB7 SURB7 protein protein human Homo sapiens Human MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDIDVLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQSLPDS DIP protein Q13503 original sequence version: 128 DIP protein Q13503 original sequence version: 100 F786169620EDC126 med17_human Mediator of RNA polymerase II transcription subunit 17 TRAP80 MED17 ARC77 DRIP80 Mediator complex subunit 17 Cofactor required for Sp1 transcriptional activation subunit 6 Transcriptional coactivator CRSP77 Vitamin D3 receptor-interacting protein complex 80 kDa component Thyroid hormone receptor-associated protein complex 80 kDa component Activator-recruited cofactor 77 kDa component CRSP6 DRIP77 protein protein human Homo sapiens Human MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQIISQPFPSLQLSISLCHSSNDKKSQKFATEKQCPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPFGHKRMRLSGPQAFDKNEINSLQSSEGLLEKIIKQAKHIFLRSRAAATIDSLASRIEDPQIQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL DIP protein Q9NVC6 original sequence version: 120 DIP protein Q9NVC6 original sequence version: 114 DIP protein Q9NVC6-1 original sequence version: 77 DIP protein Q9NVC6 original sequence version: 74 47011210952D287B med1_mouse Mediator of RNA polymerase II transcription subunit 1 Med1 Crsp210 Drip205 Pbp Pparbp Trap220 Trip2 Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Thyroid hormone receptor-associated protein complex 220 kDa component Thyroid receptor-interacting protein 2 protein protein mouse Mus musculus Mouse MKAQGETEDSERLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFEEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAAPLDKILHGSVGYLTPRSGGHLMNMKYYASPSDLLDDKTASPIILHEKNVPRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPADNKWTPSFSAVTSANSVDLPACFFLKFPQPIPVSKAFVQKLQNCTGIPLFETPPTYLPLYELITQFELSKDPDPLPLNHNMRFYAALPGQQHCYFLNKDAPLPDGQSLQGTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEMCSGSNKAKKKKSSRVPPDKPKHQTEDDFQRELFSMDVDSQNPMFDVSMTADALDTPHITPAPSQCSTPPATYPQPVSHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPPIGTPVRDSSSSGHSQSALFDSDVFQTNNNENPYTDPADLIADAAGSPNSDSPTNHFFPDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGMPMLGGDNGEPKFKGSSQADTVDFSIISVAGKALGAADLMEHHSGSQSPLLTTGELGKEKTQKRVKEGNGTGASSGSGPGSDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSSGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSLASASTSGKVKSSKSEGSSSSKLSGSMYASQGSSGSSQSKNSSQTGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSISKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSSGSHVSGTSSSSGMKSSSGSASSGSVSQKTPPASNSCTPSSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPIDSQMGASTNSSNHPMSSKHNTSGGEFQSKREKSDKDKSKVSASGGSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESGGDGLRPQIASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNVDSESESGSSIAERSYQNSPSSEDGIRPLPEYSTEKHKKHKKEKKKVRDKDRDKKKSHSMKPENWSKSPISSDPTASVTNNPILSADRPSRLSPDFMIGEEDDDLMDVALIGN DIP protein Q925J9 original sequence version: 111 DIP protein Q925J9 original sequence version: 70 C3B8121A26003A22 med20_human Mediator of RNA polymerase II transcription subunit 20 TRFP MED20 Mediator complex subunit 20 TRF-proximal protein homolog protein protein human Homo sapiens Human MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR DIP protein Q9H944 original sequence version: 128 DIP protein Q9H944 original sequence version: 119 5AA7A39981EB1498 med14_human Mediator of RNA polymerase II transcription subunit 14 TRAP170 MED14 ARC150 DRIP150 EXLM1 RGR1 Mediator complex subunit 14 Cofactor required for Sp1 transcriptional activation subunit 2 RGR1 homolog Transcriptional coactivator CRSP150 Vitamin D3 receptor-interacting protein complex 150 kDa component Thyroid hormone receptor-associated protein complex 170 kDa component Activator-recruited cofactor 150 kDa component CRSP2 CXorf4 protein protein human Homo sapiens Human MAPVQLENHQLVPPGGGGGGSGGPPSAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQISFIHQLVQSRLFADEKPLQDMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAILRGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEKSVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFIKLTRLPQYYIVVEMLEVPNKPTQLSYKYYFMSVNAADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVESKKTKRAGEMCAFNKVLAHFVAMCDTNMPFVGLRLELSNLEIPHQGVQVEGDGFSHAIRLLKIPPCKGITEETQKALDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGPNSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGTSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPAARMPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQTLQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPPGGRP DIP protein O60244 original sequence version: 134 DIP protein O60244 original sequence version: 90 144308E3F08D3D9B gata1-ccnc-1 7 14 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human association association gata1-ccnc-2 5 9 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human association association med1-gata1-1 4 11 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait Region 622-701 Region 622-701 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction med1-gata1-2 2 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait Region 386-728 Region 386-728 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association med1-gata1-3 1 11 unspecified role unspecified role prey prey Region 200-248 Region 200-248 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction gata1-med1-1 3 17 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association gata1-med1-2 6 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 11 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association