DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264181X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264180X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264179X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264174X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264173X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264178X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264184X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264175X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264182X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264177X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264176X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Togneri J., Cheng YS., Munson M., Hughson FM., Carr CM. DIP original experiment: DIP-264183X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Specific SNARE complex binding mode of the Sec1/Munc-18 protein, Sec1p. sso1_yeast Protein SSO1 SSO1 P1405 YPL232W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYNNPYQLETPFEESYELDEGSSAIGAEGHDFVGFMNKISQINRDLDKYDHTINQVDSLHKRLLTEVNEEQASHLRHSLDNFVAQATDLQFKLKNEIKSAQRDGIHDTNKQAQAENSRQRFLKLIQDYRIVDSNYKEENKEQAKRQYMIIQPEATEDEVEAAISDVGGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSARKARKNKIRCWLIVFAIIVVVVVVVVVPAVVKTR 6E4C6D35C3CD9D94 6E4C6D35C3CD9D94 snc2_yeast Synaptobrevin homolog 2 SNC2 YOR327C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSVPYDPYVPPEESNSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLVVIILLVVIIVPIVVHFS 815F027FAD8A599B 815F027FAD8A599B sec1_yeast Protein transport protein SEC1 YD8358.18C YDR164C SEC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDLIELQRNYLIGVLNQIETKNNLKFLIIDKTVETILSYLFLTPQELLNNVTSVDLIDSPTRKGQSSIEAIYILEPTKYNINCIDADFMVRPPKYRRCHIRFLPGLTNPIFQFFQSKRYIAQNLESFKPIELGFFVKESQFFETLQMEHSLQVFFNNNCKALIPTNVRKIVGSLVSLCVITGEYPIVRYSVSNPVEEEDARNGNAVVNANSLTRSIANAFQIAIDTYARNNPDFPPQNTERPRSILIITDRTLDPFAPILHDFSYQAMAYDLVANVDTQKDIYHYSAENEAGEQEEKVSKLVDLYDPDWIDLKHQHIMDANEYIQGRIKELIAKNPLLVDRSNVKNTTDLLSVVAHLKDFDEERRRLILHKTLVDECLGENAERKLADISAIEQNLSGFGMDFSGEKIKHIIDDLLPALAMKEPTILDKLRYIIAYALFRGGIIELDFIKLLNFIGVTHEHENFQQYLKIFRNYDLIDFKLIKDKPKDKPFQKEWFHDTLVNDPNIYHTSRFVPAVGNILSKVIANPLLLSEQYFPYLKDKPIELLNEEEFQAGLANTSANSSSSLRNPRHKAAWTTKSSNIKKNIPRQRFFYYVIGGISIPEIKAAYDQSNLKNRDIFIGSDEILTPTKFLDEVERLQNPREFFKFKEDQRQQVNPPDFLLREMKPVAQPVSHVHLKSQDNSPKSGTSSPKAAGSLKSEPPEKEKKRSKFSRFLKRKSHHDK B3C12AD4E01273B0 sec9_yeast Protein transport protein SEC9 SEC9 HSS7 YGR009C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGLKKFFKIKPPEEATPEQNKDTLMELGISVKNPSKKRKEKFAAYGKFANDKAEDKVYAPPGYEQYARPQDELEDLNASPLDANANEATAGSNRGSSGTQDLGNGAESNSMQDPYAIENDDYRYDDDPYARFQANKSNGRGSVNAAPYGDYGGGYNGTSLNSYNNDGPYSNQNTSNSWVNANGRNSLNHSNSTLNVGPSRQTRQPPVSTSTNSLSLDQRSPLANPMQEKRNPYADMNSYGGAYDSNTNRSSGTRQGSSKNANPYASMANDSYSNGNLNRSANPYSSRSVRQPQSQQAPMTYTPSFIASDEAARNSEVDLNEEPRTGEFDFEEVYADKSAENRAALDEPDLNAVMTNEDSIDLNASEVDHSSRQQQQQQWFMDEQQQQQQHFNATNNQYGDQRGYKTFEEIQKEEEARQQQEEDEAVDEIKQEIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKLNRSILAVHVSNPFNSKRRRREREEQLKNRKIEEKLMREQTSQQLSQSTQRIEGAMNANNNISEVRERYQRKNVLEKAKRYQFENDEEDDEMELEIDRNLDQIQQVSNRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRLAGIR EA314D73D20A10C7 EA314D73D20A10C7 sec1p-sec9p-1 5 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association sec9p-sso1p-2 3 13 unspecified role unspecified role unspecified role unspecified role Region 179-265 Region 179-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 416-651 Region 416-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sso1p-sec9p-1 9 13 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 179-265 Region 179-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role prey prey Region 416-651 Region 416-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sec9p-snc2p-1 7 13 unspecified role unspecified role unspecified role unspecified role Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-93 Region 1-93 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 416-651 Region 416-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sec9p-snc2p-2 6 13 unspecified role unspecified role unspecified role unspecified role Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-93 Region 1-93 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 416-651 Region 416-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sec1p-sec9p-2 2 13 unspecified role unspecified role prey prey Region 31-290 Region 31-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association sec9p-sso1p-3 11 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sec9p-sec1p-1 8 13 unspecified role unspecified role prey prey Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role prey prey Region 1-93 Region 1-93 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role bait bait Region 416-651 Region 416-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association sec9p-sso1p-4 12 13 unspecified role unspecified role prey prey Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role bait bait Region 416-651 Region 416-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sec1p-sec9p-3 4 13 unspecified role unspecified role prey prey Region 179-265 Region 179-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role prey prey Region 1-93 Region 1-93 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role prey prey Region 416-651 Region 416-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association sso1p-sec9p-2 10 13 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 179-265 Region 179-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role prey prey Region 1-93 Region 1-93 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role prey prey Region 416-651 Region 416-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association sec9p-snc2p-3 1 13 unspecified role unspecified role prey prey Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role prey prey Region 1-93 Region 1-93 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role bait bait Region 416-651 Region 416-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association