DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Nature 2006 imex curation Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. DIP original experiment: DIP-254846X Nature 2006 IMEx Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Nature 2006 imex curation Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. DIP original experiment: DIP-254843X Nature 2006 IMEx Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Nature 2006 imex curation Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. DIP original experiment: DIP-254840X Nature 2006 IMEx Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Nature 2006 imex curation Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. DIP original experiment: DIP-254842X Nature 2006 IMEx Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Nature 2006 imex curation Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. DIP original experiment: DIP-254845X Nature 2006 IMEx Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Nature 2006 imex curation Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. DIP original experiment: DIP-254844X Nature 2006 IMEx Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Nature 2006 imex curation Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T. DIP original experiment: DIP-254841X Nature 2006 IMEx Klotho converts canonical FGF receptor into a specific receptor for FGF23. fgf23_human Fibroblast growth factor 23 FGF23 HYPF Phosphatonin Tumor-derived hypophosphatemia-inducing factor UNQ3027/PRO9828 protein protein human Homo sapiens Human MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI DIP protein Q9GZV9 original sequence version: 136 DIP protein Q9GZV9 original sequence version: 108 6093BD0CC50C2489 p11362-14 Fibroblast growth factor receptor 1 I H3 FGFR1 BFGFR CEK FGFBR FLG FLT2 HBGFR Basic fibroblast growth factor receptor 1 Fms-like tyrosine kinase 2 N-sam Proto-oncogene c-Fgr protein protein human Homo sapiens Human MWSWKCLLFWAVLVTATLCTARPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR DIP protein P11362-14 original sequence version: 189 BFA81F8DADF4C9F4 klot_mouse Klotho Kl protein protein mouse Mus musculus Mouse MLARAPPRRPPRLVLLRLLLLHLLLLALRARCLSAEPGQGAQTWARFARAPAPEAAGLLHDTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHSGAAPSDSPIVVAPSGAPSPPLSSTGDVASDSYNNVYRDTEGLRELGVTHYRFSISWARVLPNGTAGTPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDTYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGRVSIALSSHWINPRRMTDYNIRECQKSLDFVLGWFAKPIFIDGDYPESMKNNLSSLLPDFTESEKRLIRGTADFFALSFGPTLSFQLLDPNMKFRQLESPNLRQLLSWIDLEYNHPPIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIRLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKELLPKSSALFYQKLIEDNGFPPLPENQPLEGTFPCDFAWGVVDNYVQVDTTLSQFTDPNVYLWDVHHSKRLIKVDGVVAKKRKPYCVDFSAIRPQITLLREMRVTHFRFSLDWALILPLGNQTQVNHTVLHFYRCMISELVHANITPVVALWQPAAPHQGLPHALAKHGAWENPHTALAFADYANLCFKELGHWVNLWITMNEPNTRNMTYRAGHHLLRAHALAWHLYDDKFRAAQKGKISIALQADWIEPACPFSQNDKEVAERVLEFDIGWLAEPIFGSGDYPRVMRDWLNQKNNFLLPYFTEDEKKLVRGSFDFLAVSHYTTILVDWEKEDPMKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLRFKYGDLPMYVTANGIDDDPHAEQDSLRIYYIKNYVNEALKAYVLDDINLCGYFAYSLSDRSAPKSGFYRYAANQFEPKPSMKHYRKIIDSNGFLGSGTLGRFCPEEYTVCTECGFFQTRKSLLVFISFLVFTFIISLALIFHYSKKGQRSYK DIP protein O35082 original sequence version: 106 DIP protein O35082-1 original sequence version: 82 24BD772A1F81B8EC fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS DIP protein P09038 original sequence version: 169 DIP protein P09038 original sequence version: 129 EAE98552A39D5E19 p11362-7 Fibroblast growth factor receptor 1 FGFR1 BFGFR Basic fibroblast growth factor receptor 1 CEK FGFBR FLG FLT2 Fms-like tyrosine kinase 2 N-sam Proto-oncogene c-Fgr A III HBGFR protein protein human Homo sapiens Human MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR fgfr1-kl-1 4 9 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 22-285 Region 22-285 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey Extracellular domain Region 1-980 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse direct interaction direct interaction fgf23-kl-1 3 8 unspecified role unspecified role bait bait crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association fgfr1-fgf2-4 1 11 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 12 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 22-374 Region 22-374 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse direct interaction direct interaction kl-fgf23-1 6 8 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 10 unspecified role unspecified role bait bait Extracellular domain Region 1-980 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse direct interaction direct interaction fgfr1-kl-2 7 12 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 22-374 Region 22-374 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey Extracellular domain Region 1-980 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse direct interaction direct interaction fgfr1-fgf23-1 2 8 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 12 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 22-374 Region 22-374 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey Extracellular domain Region 1-980 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse physical association physical association fgfr1-fgf2-5 5 11 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 12 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 22-374 Region 22-374 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey Extracellular domain Region 1-980 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse physical association physical association