DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264144X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264151X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264155X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264153X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264150X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264145X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264152X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264143X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264146X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264139X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264147X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264141X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264149X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264138X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264140X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264142X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264148X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Structural basis for protein-protein interactions in the 14-3-3 protein family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264154X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN DIP protein P61981 original sequence version: 126 DIP protein P61981 original sequence version: 135 B0D16C6DE1F4455D q51451_pseai exoS protein protein pseai Pseudomonas aeruginosa MHIQSLQQSPSFAVELHQAASGRLGQIEARQVATPSEAQQLAQRQDAPKGEGLLARLGAALMRPFVAIMDWLGKLLGSHARTGPQPSQDAQPAVMSSAVVFKQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQVEESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDASPELRREITDQLHQVMSEVALLRQAVESEVSRVSADKALADGLVKRFGADAEKYLGRQPGGIHSDAEVMALGLYTGIHYADLNRALRQGQELDAGQKLIDQGMSAAFEKSGQAEQVVKTFRGTRGGDAFNAVEEGKVGHDDGYLSTSLNPGVARSFGQGTISTVFGRSGIDVSGISNYKNEKEILYNKETDMRVLLSASDEQGVTRRVLEEAALGEQSGHSQGLLDALDLASKPERSGEVQEQDVRLRMRGLDLA DIP protein Q51451 original sequence version: 66 8D557449EC31F6A6 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN DIP protein P27348 original sequence version: 164 DIP protein P27348 original sequence version: 173 175534325E9E37C4 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 ywhab-ywhaq-1 7 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhae-1 14 21 unspecified role unspecified role unspecified role unspecified role Region 1-233 Region 1-233 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ywhab-1 6 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhaq-1 10 22 unspecified role unspecified role unspecified role unspecified role Region 1-234 Region 1-234 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ywhae-2 9 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhah-1 15 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhae-ywhag-1 4 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhag-1 11 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhag-2 12 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhah-2 16 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhag-ywhaq-1 3 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhah-3 17 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhae-ywhaq-1 18 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhab-2 8 23 unspecified role unspecified role unspecified role unspecified role Region 1-239 Region 1-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ywhaq-2 13 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ywhab-ywhae-1 5 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction exos-ywhab-2 1 20 unspecified role unspecified role unspecified role unspecified role Region 421-431 Region 421-431 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 23 unspecified role unspecified role unspecified role unspecified role Region 1-239 Region 1-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ywhab-ywhag-1 2 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction